KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06100Help
Entry
CGSHiEE_06100     CDS       T00543                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIF3 Curto_V2
Motif
Other DBs
NCBI-ProteinID: ABQ98573
Position
1211402..1211788
Genome map
AA seq 128 aa AA seqDB search
MQVEGKANVYKIITGILANQVLIKPLNNIPILLFIVHHGYFWKNEKPCILGMRGKRIKSL
FINSIKIAFKAYNFDVEFKDIGESRLILFLKCSTLLLIYSQILLFHKIDGTIITVNLNRL
KIVYDGYF
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtagaaggaaaagcaaatgtttataaaatcattacaggaatcctagcaaatcaa
gtattgattaagccattaaacaacattcctatactattatttattgttcatcatgggtat
ttttggaaaaatgagaaaccttgcattttaggaatgagaggtaaacgaattaaaagtttg
tttataaatagtataaaaatagctttcaaagcatataattttgatgttgagtttaaggat
ataggagaatcccgcttaatattattcttaaaatgttctaccctacttttgatatactca
caaatcttattgtttcacaagatagatgggactataataactgtaaatttaaacagatta
aagatagtttatgatggatatttctga

DBGET integrated database retrieval system