KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06105Help
Entry
CGSHiEE_06105     CDS       T00543                                 

Definition
(GenBank) DNA helicase II
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip03420  Nucleotide excision repair
hip03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hip00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    CGSHiEE_06105
   03430 Mismatch repair
    CGSHiEE_06105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hip03400]
    CGSHiEE_06105
Enzymes [BR:hip01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CGSHiEE_06105
DNA repair and recombination proteins [BR:hip03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     CGSHiEE_06105
   MMR (mismatch exicision repair)
    Other MMR factors
     CGSHiEE_06105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 UvrD_C_2 AAA_30 Viral_helicase1 AAA_12 PhoH SpoIIAA-like PRMT5
Motif
Other DBs
NCBI-ProteinID: ABQ98574
Position
1211775..1213955
Genome map
AA seq 726 aa AA seqDB search
MDISELLDGLNDKQREAVAAPLGNHLVLAGAGSGKTRVLTHRIAWLIAVENISEGSIMAV
TFTNKAAAEMRHRIQSTLAKHAQHQLFGMWIGTFHSIAHRLLRAHHLDVGLPQDFQILDS
EDQRRLIKRLLKLHNFDEKAFPPKQACWYINNKKDEGLRPNDIEDFNDRQEREWIKIYQI
YQDTCDRAGLVDFAELLIRVYELFEKKPLILQRYQQRFQHILVDEFQDTNKIQYKWIKIL
AGKTGKVMIVGDDDQSIYGWRGAQIENIQKFLKDFKAETIRLEQNYRSTANILNSANELI
ANNSDRLGKNLWTEGEKGDPVGIYSAFNELDEAKFVASQIQDWVEHGGKLDDCAVLYRSN
SQSRVIEEALIRCQIPYRIYGGMRFFERQEIKDALAYLRLINNRQDDAAFERVINTPTRG
IGDRTLDILRNLTRERQITLWQAVQVATQENMLAGRASTALLRFQELINSLQLDTAEMPL
FAQTDFVIKHSGLYEMYQQEKGEKGEVRIENLEELVTATREFIKPDDAEEMTELTAFLTH
ASLEAGEEQASPHQSCVEMMTLHSAKGLEFPRVFMVGVEEGLFPSFRSFEEPGRLEEERR
LAYVGITRAQKKLTISYAESRRLYAKEERHLPSRFIAELPRECIQEIRLRGTVTRAMNLA
KVGSLSNTSAVENEWKMGQKVKHEKFGFGTVINVEGSENNTRLQIAFQAQGIKWLIAHLA
TLEKVR
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggatatttctgaattacttgacggactcaacgataaacaacgcgaagccgtagctgct
cctcttggtaatcacttagtgctagctggtgcaggctcgggcaaaacgcgtgtattgacg
caccgtattgcttggttaattgcggtcgaaaatatttctgaaggcagcattatggcggtg
acctttaccaataaagccgcagcagaaatgcgtcatcgtattcaatctacccttgccaaa
cacgcacaacatcaattatttggtatgtggattggcaccttccatagcattgctcatcgt
ttgttgcgagctcatcatttagatgtgggattgccacaagatttccaaattttagattca
gaagatcaacgtcgtttaattaaacgattattaaaattacataattttgatgaaaaagct
tttccgcctaaacaggcttgttggtacatcaataacaaaaaagatgaaggcttgcgacca
aatgatattgaagattttaatgatcgccaagaacgtgaatggattaaaatttatcagatc
tatcaagacacttgcgatcgcgcagggttggtcgattttgctgaattattaattcgggtc
tatgaattatttgagaaaaaaccattaattttgcaacgttatcaacaacgttttcagcat
attttggtggatgagtttcaagacaccaataaaattcaatataagtggattaaaattctt
gctggaaaaacaggcaaagtcatgatcgtaggcgatgatgatcaatctatatacggttgg
cgtggcgcacaaattgaaaatatccaaaaattcttgaaagatttcaaagccgaaacaatt
cgccttgaacaaaactaccgttctaccgccaatatcctaaacagcgcaaatgaattaatt
gcaaacaatagtgatcgtcttggtaaaaatttatggacagagggtgagaaaggcgatcct
gtgggcatctattctgcctttaatgaattagatgaagcaaaatttgtcgcttcacaaatt
caggattgggtagaacatggcggaaaacttgatgattgcgctgtactttatcgtagtaat
agccaatcacgggttattgaagaagctttaattcgttgtcaaattccataccgtatttat
ggcggtatgcgtttcttcgaacgtcaagaaattaaagatgcgttagcctatcttcgtttg
attaataatcgtcaagatgatgcggcttttgagcgtgtaattaatacgccaacccgtggc
attggcgaccgcactttagatatattgcgtaacttaacacgcgaacgccaaattacctta
tggcaagcagtacaagtcgcaacacaagaaaatatgttggcagggcgagcctcaacagcc
ttattacgtttccaagaattaattaattcactacaacttgataccgcagaaatgccgctt
ttcgcacaaactgattttgtgattaaacattcgggcttatatgaaatgtatcaacaagaa
aaaggcgaaaaaggcgaagtgcggattgaaaatttggaagaattagttaccgcaacccgt
gaatttatcaaacctgatgatgcggaagaaatgaccgaactcactgcctttttaactcat
gcctctttagaagctggtgaagaacaagcctcgccgcatcaatcttgtgtagaaatgatg
acgttgcactctgcgaaaggcttagaatttcctcgtgtatttatggtgggcgtagaagaa
ggattattcccaagttttcgttcttttgaagaacccggacgtttagaagaagagcgtcgt
ttagcttatgtcggtattactcgcgcacagaaaaaactgaccatctcttatgcggaaagc
cgtcgattatatgccaaagaagaacgccatttgccatcacggtttatcgcagaattaccg
agagaatgtatccaagaaattcgtttacgagggacagtcacgcgtgcgatgaacctagca
aaagtcggttcattgtcgaataccagtgcggtcgaaaatgaatggaaaatgggtcaaaaa
gttaaacacgaaaaatttggtttcggcacagtgattaatgtggaaggatctgaaaataac
acacgtttacaaatagcgttccaagctcaaggcattaaatggttgattgcgcatttggca
acattggaaaaagtgcggtag

DBGET integrated database retrieval system