KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06135Help
Entry
CGSHiEE_06135     CDS       T00543                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip03030  DNA replication
hip03410  Base excision repair
hip03420  Nucleotide excision repair
hip03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hip00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CGSHiEE_06135
   03410 Base excision repair
    CGSHiEE_06135
   03420 Nucleotide excision repair
    CGSHiEE_06135
   03430 Mismatch repair
    CGSHiEE_06135
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hip03032]
    CGSHiEE_06135
   03400 DNA repair and recombination proteins [BR:hip03400]
    CGSHiEE_06135
Enzymes [BR:hip01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CGSHiEE_06135
    6.5.1.6  DNA ligase (ATP or NAD+)
     CGSHiEE_06135
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CGSHiEE_06135
DNA replication proteins [BR:hip03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CGSHiEE_06135
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CGSHiEE_06135
DNA repair and recombination proteins [BR:hip03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CGSHiEE_06135
   NER (nucleotide excision repair)
    Other NER factors
     CGSHiEE_06135
   MMR (mismatch exicision repair)
    Other MMR factors
     CGSHiEE_06135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase DUF3670
Motif
Other DBs
NCBI-ProteinID: ABQ98578
Position
complement(1217966..1218661)
Genome map
AA seq 231 aa AA seqDB search
MSEKLDGVRGYWNGKQLLTRQGQPLSPPAYFIKDFPPFAIDGELFSERNHFEEISSITKS
FKGDGWEKLKLYVFDVPDAEGNLFERLAKLKAHLLEHPTTYIEIIEQIPVKDKTHLYQFL
AQVENLQGEGVVVRNPNAPYERKRSSQILKLKTARDEECTVIAHHKGKGQFENVMGALTC
KNHRGEFKIGSGFNLNERENPPPIGSVITYKYRGLTSRGKPRFATYWREKK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagttagatggcgtacgcggttattggaatggaaagcaattattaacccga
caagggcaacctttatcgccgccagcttatttcattaaggattttccgccttttgcgatt
gatggcgaattatttagtgagcgaaatcattttgaggaaatttcatccatcacaaaatct
tttaaaggcgatggttgggaaaaactgaaattgtatgtttttgatgtgcctgatgcagag
ggcaatttatttgagcgtttagctaaattaaaagcgcatttacttgaacatccaacaact
tacattgaaattattgagcaaattcctgttaaagataaaacccatttatatcaatttctt
gcacaagtcgaaaatttgcaaggcgagggcgttgttgtacgcaaccccaatgcaccttat
gaacgtaagcgaagctcacaaattttaaaattaaaaacagcacgagatgaagaatgtaca
gtcattgcacaccataaaggcaaaggacaatttgaaaatgtgatgggtgctttaacttgt
aaaaatcatcggggagaatttaaaatcggttcggggtttaatttaaacgaacgagaaaat
ccccctccgataggatctgtaattacttataaatatcgaggtctcacgagtcgtggaaaa
cctcgatttgcgacttattggcgagagaaaaaataa

DBGET integrated database retrieval system