KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06165Help
Entry
CGSHiEE_06165     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YadA_anchor
Motif
Other DBs
NCBI-ProteinID: ABQ98584
Position
1222715..1223026
Genome map
AA seq 103 aa AA seqDB search
MEQLKTAANPNQAKIDNATKSYETAKNELVSTWKGTAGSVSVGNEIRGITRQITGVAAGT
YRGQSAVAVGVRYTPKPNMVISLSGSADTNNGMCAATGVSFGF
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggaacagttgaaaaccgcagctaatccaaatcaagctaagattgacaatgcgactaaa
tcttatgaaacagctaaaaatgaattagtttcaacttggaaaggcactgcgggttcggtt
tcagtggggaatgaaataagaggcataacccgccaaattactggcgtagctgcagggact
tatcgaggacaatctgccgttgcagttggggttcgttatacacctaaaccgaatatggta
attagcctttctggctctgctgataccaataacgggatgtgtgctgcaactggggtaagt
tttgggttttag

DBGET integrated database retrieval system