KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06175Help
Entry
CGSHiEE_06175     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K02742  SprT protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    CGSHiEE_06175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SprT-like DUF45 DUF3267
Motif
Other DBs
NCBI-ProteinID: ABQ98586
Position
complement(1223766..1224203)
Genome map
AA seq 145 aa AA seqDB search
MTSISLIPFRHLKMQVQRKLNQSLLLAEAYFKRKFTMPEVNYELRGIKAGVAYLQKNEIK
FNRTLLQENMDEFIRQVVPHELAHLIVYQMFGCVKPHGKEWQLVMNEIFKLPADTCHQFD
IKNVQGKTFRISLCLPNPFSNYSSA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaatatcacttattccattccgtcatttaaaaatgcaagtgcaacgcaaattg
aatcagtctttgctgcttgcagaggcttattttaagcgaaaatttacaatgccagaggta
aattatgagttacgtggtataaaggcaggcgtggcttacctacaaaaaaatgaaataaaa
tttaaccgcactttattgcaagaaaatatggatgaatttattcgacaagttgtgccacat
gagcttgcgcatttgattgtgtatcaaatgtttggttgcgtaaaaccacacgggaaagag
tggcagcttgtaatgaatgaaatttttaagcttcccgcagacacttgccatcaatttgat
ataaaaaatgtgcaaggtaaaacctttagaatatcgttgtgcttgccaaacccattttct
aactattcgtcggcataa

DBGET integrated database retrieval system