KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06180Help
Entry
CGSHiEE_06180     CDS       T00543                                 

Definition
(GenBank) S-adenosylmethionine synthetase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00270  Cysteine and methionine metabolism
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CGSHiEE_06180
Enzymes [BR:hip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     CGSHiEE_06180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Motif
Other DBs
NCBI-ProteinID: ABQ98587
UniProt: A5UCT6
Position
complement(1224493..1225647)
Genome map
AA seq 384 aa AA seqDB search
MSSYLFTSESVSEGHPDKIADQISDAVLDEILKQDPKARVACETYVKTGMALVGGEITTS
AWVDIENLTRKVICDIGYEHSEMGFDGHSCAVLNAIGKQSADINQGVDRENPLDQGAGDQ
GIMFGYATNETDVLMPAAITYAHRLMEKQAEVRKSGKLAWLRPDAKSQVTLKYEDNKIVG
VDAVVLSTQHSEEVSQKDLHEGVMEEIIKPVLPTEWLSKETKFFINPTGRFVIGGPMGDC
GLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQLS
YAIGVADPTSIMVETFGTGKVANELLVSLVREFFDLRPYGLIKMLDLIQPIYRETAAYGH
FGREQFPWEKVDHAEDLRIAAGLK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtctagctatttatttacatctgaatctgtctctgaagggcatccagataaaattgcc
gatcaaatttctgatgcggtacttgatgaaatcctaaaacaagatccaaaagcacgagta
gcttgtgaaacttacgtaaaaacgggtatggcattggttggtggtgaaattacaacatca
gcatgggttgatattgagaatttaacccgtaaagtgatttgtgatattggttatgaacat
tctgaaatgggttttgatggtcattcttgtgcggtgcttaatgcgattggtaaacaatct
gcagatattaatcaaggcgttgatcgtgaaaatccattagatcagggcgcaggcgaccaa
ggtattatgtttggttatgccaccaatgaaacggatgtattaatgccagcagccattact
tatgctcatcgtttaatggaaaaacaagctgaagtgcgtaaaagcggtaaattagcatgg
ttacgcccagatgcgaaaagccaagttacgttaaaatatgaagataataaaattgttggt
gtggatgcggttgttctttctactcaacattctgaagaagttagccaaaaagatttacat
gaaggtgtgatggaagaaattatcaaacctgtgttaccaactgaatggctttctaaagaa
acaaaattcttcattaacccgactggtcgttttgttattggtggaccgatgggggattgt
ggtttaactggccgtaaaatcatcgtagatacttacggtggtgctgctcgtcacggtggt
ggcgcattctcaggaaaagatccatctaaagtagatcgttctgcggcttatgctgcacgt
tatgtcgcaaaaaatattgtggcagctggtttagcagatcgttgtgaaatccaactttct
tatgcgattggtgtggctgatccaacatctattatggtcgaaacctttggaactggaaaa
gttgcaaatgaattattagtgtcattagttcgtgagttttttgatttacgtccttatggc
ttaattaaaatgttagatttaatccaaccaatctatcgtgaaacggcagcttatggccat
ttcggtcgtgagcaattcccttgggaaaaagtggatcacgcagaagatttacgtattgcg
gcaggtttaaaataa

DBGET integrated database retrieval system