KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06185Help
Entry
CGSHiEE_06185     CDS       T00543                                 

Definition
(GenBank) para-aminobenzoate synthase component II
  KO
K01664  para-aminobenzoate synthetase component II [EC:2.6.1.85]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CGSHiEE_06185
Enzymes [BR:hip01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     CGSHiEE_06185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ABQ98588
Position
complement(1225732..1226313)
Genome map
AA seq 193 aa AA seqDB search
MKLLIINNHDSFTFNLVDLIRKLNVPYDVLNVEDLKENTAENYSHILISPGPDVPRAYPQ
LFSMLEKYYQQKSILGVCLGHQTLCEFFGGTLYNLENVRHGQKRTLKVRSNSPLFFDLPT
EFNIGLYHSWAVQKEDFPDCLEITALCDEDVVMAMQHKSLPIYGVQFHPESYMSDFGEQI
LRNWLAIHPTTTP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaattactcatcattaataatcacgattcttttacttttaacttggtggatttaatt
cgaaaattaaatgtgccttatgatgttttaaacgtagaagatttgaaagaaaatacagcg
gaaaattatagccatatattgatttcgccaggacccgatgtaccacgcgcttatccacaa
cttttttccatgttggaaaaatattatcagcaaaaatctattttaggtgtgtgtttaggg
catcaaaccttatgtgaattttttggtggtacattgtataacttagagaatgttcgtcac
gggcagaaacgaacattaaaagtgcggtcaaattctccattgttttttgatcttccaact
gaatttaatatcggcttatatcattcttgggctgtacagaaagaagattttcctgattgc
ctagaaattaccgcactttgtgatgaagatgtagtgatggcaatgcaacataaatctttg
ccaatttatggtgttcagtttcatccagaatcttatatgtcagattttggcgagcaaatt
ttgcgtaattggttggcgattcatcccacaactaccccataa

DBGET integrated database retrieval system