KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06195Help
Entry
CGSHiEE_06195     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K02619  4-amino-4-deoxychorismate lyase [EC:4.1.3.38]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CGSHiEE_06195
Enzymes [BR:hip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.38  aminodeoxychorismate lyase
     CGSHiEE_06195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: ABQ98590
Position
1227341..1227907
Genome map
AA seq 188 aa AA seqDB search
MFPLFETLCIENGKIQNIDLHQVRYERSLREYYGKSAVKIFNLFSLIQLPAPLQNQLVRC
RIDYNAETTQIQYFEYQRKIYRTFQPVICDDIEYSLKYLDRSLINTLFARRGACDEIMII
KNGKVTDCSIGNLIFRQGKKWYTPDTPLLLGTQREKLLQEGKIQERTIFQEDIVNFDEIK
IINAMNSL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgttccctctatttgaaaccctttgtattgaaaacgggaaaattcaaaatatcgattta
caccaagtgcgatatgaacgtagtttgcgtgaatattatggcaaaagtgcggtgaaaatt
tttaatcttttttcactcattcaacttcctgcgcccttacaaaatcaattagttcgctgc
cgcattgattacaatgccgaaaccacacaaattcaatattttgaataccaacgaaaaatc
taccgcacttttcaacctgtaatttgtgatgacattgaatatagtttgaaatatttagat
cgcagtttaattaatacattatttgctcgacgtggtgcttgtgatgaaattatgattatc
aaaaatggaaaagtgacagattgttccatcggtaatttaatttttcgccaaggaaaaaaa
tggtacacgccagacacgccattgcttttaggcacacaacgagaaaaattattacaagaa
gggaaaattcaagaacgcacaatattccaagaagatattgtcaattttgacgaaattaaa
atcattaacgcaatgaatagcttataa

DBGET integrated database retrieval system