KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06200Help
Entry
CGSHiEE_06200     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K09802  uncharacterized protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CGSHiEE_06200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF496
Motif
Other DBs
NCBI-ProteinID: ABQ98591
UniProt: A5UCU0
Position
complement(1227947..1228291)
Genome map
AA seq 114 aa AA seqDB search
MEIVNKQSFQDVLEYVRMYRLKNRIKRDMEDNNRKIRDNQKRILLLDNLNQYIRDDMTIA
EVRGIIESMRDDYESRVDDYTIRNAELSKQRREASTKMKEQKKAHAELLKNAEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgtgaataaacaatcttttcaagatgtgttggaatacgtgcgtatgtatcgt
ttaaaaaatagaattaaacgagatatggaagacaataatcgtaagattcgcgataaccaa
aaacgcatattgttgttggataatttaaatcaatatattcgtgatgatatgactattgca
gaagtacgcggaattattgaaagtatgcgtgatgattatgaaagccgtgtggatgattac
acaattcgcaatgctgaactttctaagcaacgccgtgaagcgagtacgaaaatgaaagaa
cagaaaaaagcacacgcagaattattgaaaaatgctgaaaaataa

DBGET integrated database retrieval system