KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06220Help
Entry
CGSHiEE_06220     CDS       T00543                                 

Definition
(GenBank) conserved glutaredoxin-related protein
  KO
K07390  monothiol glutaredoxin
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hip03110]
    CGSHiEE_06220
   03029 Mitochondrial biogenesis [BR:hip03029]
    CGSHiEE_06220
Chaperones and folding catalysts [BR:hip03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CGSHiEE_06220
Mitochondrial biogenesis [BR:hip03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    CGSHiEE_06220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin GST_N_3
Motif
Other DBs
NCBI-ProteinID: ABQ98593
Position
complement(1230836..1231159)
Genome map
AA seq 107 aa AA seqDB search
METLDKIKKQISENPILIYMKGSPKFPSCGFSARASEALMNCKVPFGYVDILQHPDIRAE
LPTYANWPTFPQLWVDGELIGGCDIILEMYQAGELQTLLAEVAAKHV
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccttagacaagatcaaaaagcaaattagtgaaaaccccattcttatttatatg
aaaggttcgccaaaatttccatcttgtggtttttctgctcgtgcatctgaggcattaatg
aattgcaaagtgccttttggttatgtagatattttgcaacatccagatattcgtgctgag
ttaccaacatatgcaaattggccaactttcccacaattatgggttgatggcgaattaatt
ggtggttgtgatattattttagaaatgtatcaagcaggcgaattgcaaactttattagct
gaagtggcagcaaaacacgtttaa

DBGET integrated database retrieval system