KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06225Help
Entry
CGSHiEE_06225     CDS       T00543                                 

Definition
(GenBank) Outer membrane protein P5
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_06225
Transporters [BR:hip02000]
 Other Transporters
  Pores ion channels [TC:1]
   CGSHiEE_06225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA_membrane OmpA OMP_b-brl Pilus_CpaD Maf
Motif
Other DBs
NCBI-ProteinID: ABQ98594
Position
complement(1231310..1232026)
Genome map
AA seq 238 aa AA seqDB search
MLDGLDVYGKAGVALVRSDYKFYEDANGTRNHKEGRHTARASGLFAVGAEYAVLPELAVR
LEYQWLTRVGKYRPQDNPNTAINYNPWIGSINAGISYRFGQGAAPVVAAPEVVSKTFSLN
SDVTFAFGKANLKPQAQATLDSIYGEMSQVKSAKVAVAGYTDRIGSDAFNVKLSQERADS
VANYFVAKGVAADAISATGYGKANPVTGATCDQVKGRKALIACLAPDRRVEIAVNGTK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtgttagacggtttagatgtttatggcaaagcaggtgttgctttagtacgttctgattat
aaattttatgaagatgcaaacggtactcgtaaccacaaggaaggtcgtcacacagcacgt
gcctctggtttatttgcagtaggtgcagaatacgcagtattaccagaattagcagttcgt
ttagaataccaatggctaactcgcgtaggtaaataccgccctcaagataacccaaatacc
gcaattaactacaacccttggattggttctatcaatgcgggtatttcttaccgtttcggt
caaggcgcagcgccagttgtagcagcacctgaagttgtaagcaaaactttcagcttaaac
tctgatgtaactttcgcatttggtaaagcaaacttaaaacctcaagcacaagcaacatta
gacagcatctatggcgaaatgtcacaagttaaaagtgcaaaagtagctgttgctggttac
actgaccgtattggttctgatgcgttcaacgtaaaactttctcaagaacgtgcagattca
gtagctaactactttgttgctaaaggtgttgcagcagacgcaatctctgcaactggctac
ggtaaagcaaacccagtaactggtgcaacttgtgaccaagttaaaggtcgtaaagcgctt
atcgcttgtcttgctccagaccgtcgtgtagaaatcgcagtaaacggtactaaataa

DBGET integrated database retrieval system