KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06230Help
Entry
CGSHiEE_06230     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4 Fer4_8 Fer4_17 Fer4_10 Fer4_20 Fer4_21 Fer4_4 BBE Fer4_18 Fer4_7 Fer4_2 Fer4
Motif
Other DBs
NCBI-ProteinID: ABQ98595
Position
1232778..1235861
Genome map
AA seq 1027 aa AA seqDB search
MLPNLNRIPQVEQYVLDYLDDLQCQHFEGDIATKYADRLSLATDNSVYQQLPQAILFPKN
VADIVRITKLANLPKYQSISFTPRGGGTGTNGQSINNNIIVDLSRHMTAILELNVKERWV
KVQAGVVKDQLNQFLKPHGLFFAPELSTSNRATLGGMINTDASGQGSLQYGKTSNHVLAL
RAVLMNGEILDTSAVNSVDVLENIDALKLSESSKRLHQTIAQHCKEKRAAIIKDLPQLNR
FLTGYDLKNVFNEDESEFNLTRILTGSEGSLAFICEAKLNLLPIPQYRTLINIKYRSFDA
ALRNAPFMVKANALSVETVDSKVLNLAKQDIIWHSVNELLTEDETDPILGLNIVEFAGNN
KEKIDRQVTALCRSLDEKIEHNQDHIIGYQVCSDLPSIERIYAMRKKAVGLLGNAKGAAK
PIPFVEDTCVPPENLADYISEFRALLDQHNLQYGMFGHVDAGVLHVRPALDLCDKEQVKL
FKQISDEVAELTIKYGGLLWGEHGKGVRSHYGEKFFTPELWHELRYIKTLFDPNNRLNPG
KICTPLDSKEELYSILSPMRADKDRQIPIQVRDEFKGAMNCNGNGLCFNFDEHSIMCPSM
KVSKNRVFSPKGRAAMVREWLRLMANENVSSEQLDFRKTEIKLTALVKRLSNTVQKWRGD
YDFSHEVKAAMDTCLACKACASQCPIKIDVPSFRAKFFHFYHSRYLRPAKDHIVANLEIA
APYMAKQAKFFNYFTKLKVTQTLVEKTLGMTDLPLLSEPNLQQQLVEIHYQGKSLEELEG
LSAVEKNDILFIVQDPYTSYYDAKVVRDFVMLTQELGFTPILLPFKPNGKAMHIKGFLKR
FSKTAKTQAEFLNRMAKLGIPLVGVDPAIVLSYRDEYKEALQEKRGDFHVLTAHEWLKQR
LQNADLQEKLKNIAKTDRTFDWYLFPHCTESTFMPNSPKEWQEIFGRFGQQLNVEKVGCC
GMAGVFGHEVQNQKMSREIYDVSWHKKLHEKDPHFCLATGYSCRSQVKRYEHVVLKHPVQ
ALLEILA
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgttgccaaatctaaatcgcattcctcaagttgaacaatatgtacttgattatcttgat
gatcttcaatgccaacattttgagggggatattgcgacaaagtatgcagatagattaagt
ctggctacggataacagcgtttaccaacaacttccacaagcgattctttttccgaaaaat
gttgctgatatagtgcgtataaccaaattggcaaatttaccaaaatatcaatcaatcagc
tttacgcctcgcggtggaggcactggcacaaatggtcaatctatcaataacaatataata
gtggatctttctcgtcatatgactgccatcttagaactcaatgtaaaagaacgttgggtt
aaagtacaagcaggtgtcgtaaaagatcaacttaatcaatttttaaaaccacatggtttg
ttctttgctccagagttatccaccagcaatcgagcaacgttaggcggaatgattaacaca
gatgcatctgggcaaggttcattgcaatatggtaaaacctctaatcacgttttggcattg
cgtgccgtattaatgaacggtgaaattttagatacaagtgcggtcaattctgttgatgtt
ttagaaaacattgatgcgcttaaattaagtgagagtagcaaaagactccatcaaaccatt
gcgcaacactgtaaagaaaaaagagcggctatcattaaagatctgccacaacttaaccgt
tttttaacgggttacgatctgaaaaatgtattcaatgaagatgaaagtgaatttaatctc
acgagaattctcactggctctgaaggttctctcgcatttatttgtgaagccaaactcaat
cttctgcctattccgcagtatcgcacgctcatcaatattaaatatcgttcttttgatgcg
gcattacgcaatgcgccttttatggtgaaagccaatgcgctttctgtggaaaccgttgat
tccaaagtcttaaacctcgccaaacaagatattatttggcactctgtgaatgaacttctt
acagaagatgaaacggatccaattcttggtttaaatattgtggaatttgctggtaataat
aaagaaaaaatagaccgccaagtcaccgcactttgtcgctcacttgatgaaaaaatcgaa
cacaaccaagatcacattattggctatcaagtttgttctgatttaccttctattgaacgt
atttatgcaatgcgaaaaaaagccgtgggcttacttggtaatgcaaaaggtgctgccaaa
ccgattcctttcgtggaagatacttgtgtccccccagaaaatcttgcggattacatcagt
gaatttcgcgctttattagaccagcacaatttacaatatggcatgtttggtcacgtggat
gctggtgtgttacacgttcgcccagcgcttgatttatgcgataaagaacaagtgaaatta
tttaaacaaatttcagatgaagtggcagaacttacgattaaatatggtggattactttgg
ggagagcatggaaaaggcgtgcgttcccattacggcgaaaaattctttaccccagaactc
tggcacgaacttcgttatatcaaaaccttattcgatccgaacaatcgcttaaatcccggc
aaaatctgtacgcctttggattccaaagaggaactttattctattctttcgccgatgcga
gctgataaggatcgccaaattcctatccaagtgcgtgatgaatttaagggtgcgatgaac
tgcaatggaaacggcttatgtttcaattttgatgaacacagcattatgtgcccatcgatg
aaagtcagtaaaaaccgtgtattttcgccgaaaggtcgtgcagctatggttcgagaatgg
cttcgattgatggcgaatgaaaatgtttcgtccgaacaattagacttccgtaaaacagaa
ataaaactaaccgcacttgtaaaaagactaagcaatacagttcaaaaatggcgaggcgac
tatgatttttctcacgaagtgaaagctgcaatggacacttgccttgcttgtaaagcctgt
gcgagccaatgcccgattaaaatcgatgtaccaagtttccgtgcgaaattctttcatttt
tatcatagccgctacttacgccccgcaaaagatcacattgtagcaaatttagaaatcgca
gcgccttatatggcaaaacaggcaaaattctttaattattttaccaagctaaaagtcacg
caaacattagtggaaaaaacattaggaatgactgatttaccgttactttcagaacccaat
ttgcaacaacaactggtggaaattcattatcaaggcaaatccttggaagaattggaaggc
ttaagtgcggtagaaaaaaacgatattttatttattgtgcaagatccttacacatcttac
tatgatgcgaaagtggtacgcgattttgttatgcttacgcaggaattaggctttacacca
attttgttgccatttaaaccaaacggcaaagcaatgcacattaaaggtttcttaaaacgc
tttagcaaaacagcaaaaacccaagccgagtttttaaatcgaatggcaaaattaggcatt
ccgcttgtgggcgttgatccagccatcgtgctatcttatcgagacgaatacaaagaagca
ctacaagaaaaacggggcgactttcacgttctcaccgcacacgaatggttaaaacaaaga
ttacaaaatgcggatttacaagagaagttaaaaaacatcgccaaaactgaccgcactttc
gattggtatttattcccgcattgtacggaatctacttttatgccgaacagtccaaaagaa
tggcaagaaatttttggaagatttggacaacaacttaatgtagaaaaagtaggatgttgc
ggtatggctggtgtatttggacatgaagtgcaaaatcaaaaaatgagccgagaaatctac
gatgtatcctggcacaaaaaactgcatgaaaaagatccgcacttttgtttagcaactggt
tattcttgccgcagtcaggtaaaacgttatgaacatgtggtgttaaagcaccctgtgcag
gcattattagaaattttagcgtaa

DBGET integrated database retrieval system