KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06240Help
Entry
CGSHiEE_06240     CDS       T00543                                 

Definition
(GenBank) ferrochelatase
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00860  Porphyrin and chlorophyll metabolism
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CGSHiEE_06240
Enzymes [BR:hip01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     CGSHiEE_06240
    4.99.1.9  coproporphyrin ferrochelatase
     CGSHiEE_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferrochelatase CbiX EIF_2_alpha DDE_Tnp_ISL3 CheB_methylest
Motif
Other DBs
NCBI-ProteinID: ABQ98597
UniProt: A5UCU6
Position
1236288..1237259
Genome map
AA seq 323 aa AA seqDB search
MTKSAKIGVLLANLGTPDSPTPKSISRYLWQFLTDPRVVDLPRCKWYPLLKAIILPLRSK
RIAKNYQAIWTEQGSPLLAISRQQKDALQAYLDTQNINAQVEIAMTYGNPSIQSAVKNLL
KNQVERIIVLPLYPQYSSSTTGAVFDAFANALKEERGLVPFDFIHSYHIDENYINALANS
IKVRLKSDEFLLFSYHGIPLRYEKMGDYYREHCKQTTIAVVNKLGLTENQWGMTFQSRFG
REEWLQPYTDKFLESAATQNIQKIAVICPGFSVDCLETIEEIDKENRENFLKNGGQSYQY
IPALNVEHAHIEMMGKLILEKLA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatccgcaaaaatcggcgtattacttgccaatctaggcacgccagatagccca
acaccgaagtcaatcagccgttatttatggcaatttttaacggatcctcgcgtggtagat
ttaccccgttgcaaatggtatccactgcttaaagccattattttaccattgcgttcaaaa
cgtatcgccaaaaattatcaagcaatctggacagaacaaggttcgcctttacttgccatt
tcacgacaacaaaaagacgcattacaagcctatttagatacgcaaaatatcaatgctcaa
gtagaaattgccatgacgtacggcaatccatcaatacaaagtgcggtgaagaacttgctt
aaaaatcaagttgagcgaattattgttttgcctctttatccgcaatactctagctcaacc
acgggcgcagtatttgatgctttcgctaatgcccttaaagaagaacgaggattagtgcct
tttgatttcatccattcttatcatattgatgaaaattacattaacgccttagcaaactcc
ataaaagtgaggttaaaatctgatgagtttttactattttcttatcacggtattcctctg
cgttatgaaaaaatgggcgattattatcgtgaacattgtaaacaaacgactattgcagtt
gttaataagctaggcttaacagaaaaccaatggggaatgacgtttcaatcgcgctttggg
cgtgaagaatggctacagccttacaccgataaatttttagaatcagctgcaacacagaac
attcaaaaaattgccgttatttgcccgggtttctccgtagattgtttagaaaccattgaa
gaaattgacaaagaaaatcgagaaaattttctaaaaaatggcgggcaatcttatcaatat
attcccgcacttaatgtagagcatgcacatattgaaatgatgggaaaattgatcctagaa
aaacttgcttaa

DBGET integrated database retrieval system