KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06250Help
Entry
CGSHiEE_06250     CDS       T00543                                 

Gene name
hemH
Definition
(GenBank) ferrochelatase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CGSHiEE_06250 (hemH)
Enzymes [BR:hip01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     CGSHiEE_06250 (hemH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA FAD_oxidored HI0933_like K_oxygenase Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABQ98599
Structure
PDB: 

Position
1238270..1239226
Genome map
AA seq 318 aa AA seqDB search
MSDIKHAKLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTDEIENWPGDFEMT
TGSGLMQRMLQHAEKFETEIVFDHINRVDLSSRPFKLFGDVQNFTCDALIIATGASARYI
GLPSEENYKGRGVSACATCDGFFYRNKPVGVIGGGNTAVEEALYLANIASTVHLIHRRDS
FRAEKILIDRLYKKVEEGKIVLHTDRTLDEVLGDNMGVTGLRLANTKTGEKEELKLDGLF
VAIGHSPNTQIFQGQLELNNGYIIVKSGLDGDATATSVEGVFAAGDVMDHNYRQAITSAG
TGCMAALDAERYLDAQEA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatcaaacacgcaaaacttttaattttaggctcaggccctgctggttataca
gcagccatttatgcggcacgtgcaaacttaaaaccagtactggtgactggtttgcaacaa
ggtggacagctgactaccacagatgaaattgagaactggccgggcgattttgagatgact
actggttcaggtttaatgcaacgtatgttgcaacatgcagaaaaatttgaaacagaaatc
gtcttcgatcatatcaatcgcgtagatttatcttctcgcccattcaaactttttggcgat
gtgcaaaatttcacttgtgatgcgttaattatcgcaacgggtgcctctgcacgttatatt
gggttgccttcagaagaaaactacaaaggccgtggggtttcagcttgcgcaacctgtgat
ggtttcttttatcgtaataagcctgttggtgtcattggtggtggaaatactgcggtggaa
gaagcgctttacttagccaatattgcaagtacagtgcatttaatccaccgtcgcgatagt
ttccgtgcggaaaaaatccttatcgatcgtttatacaaaaaagtagaagaagggaaaatc
gttcttcatactgaccgcactttagatgaagtattgggcgataatatgggcgtaactgga
ttacgtttagccaacacaaaaactggggagaaagaagaactcaaattagatggcttattc
gtggcgattggtcattcgccaaatacgcaaattttccaagggcaactagaattgaataat
ggctatatcattgtaaaatctggtcttgacggcgatgcaaccgccacttctgtggaaggc
gtgttcgcagctggcgatgtcatggatcacaattatcgccaagccattacctccgcagga
actggttgtatggcagccttggatgcagaacgctatttagatgctcaagaagcataa

DBGET integrated database retrieval system