KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06255Help
Entry
CGSHiEE_06255     CDS       T00543                                 

Definition
(GenBank) cysteine/glutathione ABC transporter membrane/ATP-binding component
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hip00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CGSHiEE_06255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_06255
Transporters [BR:hip02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    CGSHiEE_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase AAA_21 Zeta_toxin AAA_16 MMR_HSR1 AAA_29 IstB_IS21 AAA DUF815 Dynamin_N Mg_chelatase T2SSE AAA_23 DUF106 AAA_5 DLIC FeoB_N Roc
Motif
Other DBs
NCBI-ProteinID: ABQ98600
Position
1239298..1241058
Genome map
AA seq 586 aa AA seqDB search
MNKLRQKYLQKWLRAQQEPIKKLMRANIVLATLSSFILVMQTYFLATLLDKLIMQNVPRD
ELIPYFLGLIIGFGIRAIILWAREKIGFQSGQLLRNHIRQKILDKIHLVGPATINQKPAG
SWASIMLEQVENLHNFYARFLPQQSLSAIVPVVIFIAVFPLNWAAGLILMITAPLVPLFM
IIVGIAAADNSQKNMDTLSRLSAQFLDRLRGLETLRLFNRTSEQTEHIENATEDFRETTM
DVLKLAFLSSAVLEFFTSISIALMAVYFGFSYLGQIEFGTYNAPLTLFTGFFCLILAPEF
YQPLRDLGTYYHDRAAGIGAADAIVDFLESDYLTVHQNEKTISLESAVEISAENLVVLST
QGSALTKPLNFQIPANHNVALVGQSGAGKTSLINAILGFLPYEGSLKINGQELRESNLAD
WRKHITWVGQNPLLLQGTIKENLLLGNIQANDEEINQALMRSQAKEFTDKLGLHHEIKDG
GLGISVGQAQRLAIARALLRKGDLLLLDEPTASLDAQSENLVLQALNEASQHQTTLMITH
RIEDLKQCDQIFVMQRGEIVQQGKFTELQHQGFFAELLAQRQQDIQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttcgccaaaaatatttacaaaaatggcttcgcgcacaacaagaacctatc
aaaaaattaatgcgtgcaaacattgtcttagctacgctttcttcattcattttagtcatg
caaacttattttcttgcgacgttgctcgataaactgattatgcaaaatgtgcctcgtgat
gaacttattccttattttctcgggctaattatcggcttcgggatacgtgctattatttta
tgggcacgcgaaaaaataggtttccaaagcggacaattattacgcaaccatattcgtcaa
aaaattctggataaaattcatcttgtcggccctgcgacaatcaatcaaaaaccagctgga
agttgggcaagcattatgttggaacaagttgaaaacttacataatttctatgcccgtttt
ctgcctcaacaaagtctttcagccattgttccagtggttattttcattgctgtatttccc
ttgaactgggctgcaggcttaatcttaatgattaccgcaccgcttgttcctctgtttatg
atcattgtcggtattgctgcggctgacaacagccaaaaaaatatggataccctttctcgc
ctcagtgcccaatttttagatcgcttacgcggtttggaaaccttgcgtctttttaaccgc
acttctgaacaaactgagcatattgaaaatgccactgaagatttccgtgaaaccacaatg
gatgtgctaaaactcgcttttctctcttctgcagtattggaattttttacctctatttcc
attgcactgatggcggtctattttggttttagctacttaggtcaaattgaatttggtacc
tataatgcaccgcttacacttttcacaggtttcttttgtttaattcttgcacctgaattt
tatcaacccttacgcgatctaggcacctattaccacgaccgtgcagcaggtattggtgca
gcggatgccattgttgattttttagaatctgattatttaactgtacatcaaaatgaaaaa
acaatttctttagaaagtgcggttgaaatttctgccgaaaatttagtggtgctttcgaca
cagggttcagcattaaccaagccgttaaacttccaaattccagcaaatcataatgttgcg
cttgtaggacaaagtggcgcgggaaaaacttcattaataaatgcgattctgggcttttta
ccttatgagggctcgctcaaaattaatgggcaagaacttcgcgaaagtaatctagctgac
tggcgcaaacatattacgtgggtaggacaaaatccattgttattacaaggcacaattaaa
gaaaacttactacttggcaatattcaagccaacgatgaagaaattaatcaagctttaatg
cgttctcaagcgaaagaatttaccgataaacttggacttcatcacgaaataaaagatggt
ggattaggcatttctgtgggacaagcgcaacgccttgccattgctcgggcattgttacgc
aaaggcgatttacttctgctcgatgagccaaccgcaagcctagatgcgcaatcagaaaat
cttgttttacaagcattgaatgaagcaagtcagcatcaaactacactgatgattacacac
cgaattgaagatttgaaacaatgtgatcaaatttttgtgatgcaacgaggagaaatagta
cagcaaggtaaatttaccgaattacaacatcaaggtttctttgctgaactactcgctcaa
cgacaacaggatatccaataa

DBGET integrated database retrieval system