KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06265Help
Entry
CGSHiEE_06265     CDS       T00543                                 

Definition
(GenBank) anaerobic ribonucleoside-triphosphate reductase activating protein
  KO
K04068  anaerobic ribonucleoside-triphosphate reductase activating protein [EC:1.97.1.4]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CGSHiEE_06265
Enzymes [BR:hip01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     CGSHiEE_06265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_12 Fer4_14 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ABQ98602
Position
1243037..1243504
Genome map
AA seq 155 aa AA seqDB search
MNYLQYYPTDVINGEGTRCTLFVSGCTHACKGCYNQKSWSFSAGVLFDEAMKQQIINDLK
DTRIKRQGLTLSGGDPLHPRNVETLLPFVQRVKRECPDKDIWVWTGYKLDELDEQQRAML
PYIDVVIDGKFIQEQADPSLVWRGSANQIIHRFKL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctccaatactacccgaccgatgttatcaatggcgaaggcacaagatgcaca
cttttcgtcagtggctgtacgcacgcttgcaaaggttgctataaccaaaaaagttggtca
ttttcagcgggtgtattatttgatgaagcaatgaaacaacaaatcatcaatgatttaaaa
gacactcgcattaaacgccaagggctaacgctttcaggtggcgatccacttcatccccgt
aacgtagaaacattattgccatttgtgcaacgcgtaaaacgagaatgccccgataaagat
atctgggtttggacaggttataagctagatgaattagatgaacaacaacgtgctatgttg
ccttatattgatgtcgtaattgatgggaaatttattcaagaacaggcagacccaagttta
gtttggcgaggttccgcaaatcaaattattcatcgatttaagttataa

DBGET integrated database retrieval system