KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06275Help
Entry
CGSHiEE_06275     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE Colicin_V TM_helix
Motif
Other DBs
NCBI-ProteinID: ABQ98604
Position
complement(1245020..1245229)
Genome map
AA seq 69 aa AA seqDB search
MILLKSAVEILNEFLAALFYIISLLFSRSLAKSFYSKYSRYIDNLAGAIFLFFGGYLVYS
GVLATAAAF
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
ttgattttattgaaaagtgcggttgaaattttaaatgaatttttagccgcacttttttat
attatttcattgctattttctcgatcacttgctaaatctttttacagcaaatacagccgt
tatattgataatcttgctggggcaattttcttatttttcggcggctatttagtttattca
ggcgtgctagccactgcagccgcattttaa

DBGET integrated database retrieval system