KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06285Help
Entry
CGSHiEE_06285     CDS       T00543                                 

Gene name
nrdG
Definition
(GenBank) anaerobic ribonucleotide reductase-activating protein
  KO
K03592  PmbA protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hip01002]
    CGSHiEE_06285 (nrdG)
Peptidases [BR:hip01002]
 Peptidases of Unknown Catalytic Type
  Family U62
   CGSHiEE_06285 (nrdG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PmbA_TldD
Motif
Other DBs
NCBI-ProteinID: ABQ98606
Position
complement(1245980..1247335)
Genome map
AA seq 451 aa AA seqDB search
MKTAENSTALLKAQEQELRQAVSFAVELATKAGASAEVAVTKVSGLSVSARLQEIENVEF
TNDGALGISVYMGQQKGNASTSDLSESAIKNAVEAALAIAKYTSPDDCTGLADKDLMAFD
APDLELYHAADVNVDKATELALQAEKAALEADERIINSNGASFNSHTGVKVYGNSHGMLQ
SYLSSRYSLSCSVIGGVEDALENDYEYTISREFDKLQSPIWVGENCAKKVVSRLNPQKLS
TREVPVIFLNDVATGIISHFAAAISGGSLYRKSSFLLDHLGKQVLPDWFNISERPHLLRR
LASTPFDSEGVRTQDREIVENGILQTYLVTSYSGKKLGMPSTGHAGGIYNWLVKPNLTGG
LTALLRQMGTGLLVTDVMGQGVNIVTGDYSRGASGFWVENGEIQYPVAEITIAGQLQDML
KNMLAVADDIEHRSNIQTGSILLDKMKISGN
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagctgaaaattcaaccgcacttttaaaagcacaagaacaagaattacgtcaa
gccgtcagttttgcagtggagttagcaacgaaagctggcgcaagtgcagaagtcgcagtc
acaaaagtgagcggtttatccgtatctgctcgtttgcaagaaattgaaaacgtagaattt
actaatgatggcgcattggggatctccgtttatatggggcaacaaaaaggcaatgcttct
acttccgatctaagcgaaagcgcaattaaaaatgcggtagaagccgcacttgcaattgca
aaatacacttcacccgatgattgcacagggttggctgataaagatctaatggcttttgat
gcgcctgatttagaactttatcatgctgctgatgtgaatgttgataaagcaacagaactt
gcacttcaggctgaaaaggcggctttagaggcggatgaacgcattataaatagtaatggt
gcaagttttaattcacatacaggcgtgaaagtttatggaaatagccatggtatgttgcaa
agttatttatcaagccgttattccttatcttgttcggttattggtggcgtagaagatgcc
ttagaaaatgattacgaatacacgatctctcgtgagttcgataaactccaatcgccaatt
tgggttggcgaaaattgtgcaaagaaagtcgtttctcgtttaaatcctcaaaaattgagt
acacgagaagtgcctgtcattttcttaaatgatgttgcaacgggtattatttctcatttt
gccgctgcaataagtggtggcagcttatatagaaaatcaagtttcttactcgatcattta
ggtaaacaggtcttaccagattggttcaatattagtgagagaccacatttattacgccgt
ttagcttctacgccttttgatagtgaaggtgttcgcacgcaagatcgtgaaattgtcgaa
aacggcatattacaaacttatttagtgacaagttacagtggtaaaaaacttggtatgcca
agtacagggcacgctggaggtatttacaactggcttgttaagccaaatttaacgggtgga
ttgaccgcacttttacgtcaaatgggaacaggcttactcgtaacagatgttatggggcaa
ggtgtcaatatcgttacaggcgattattcccgtggtgcatcaggtttttgggtggaaaat
ggagaaattcaatatccagtcgccgaaattaccattgcgggacaattgcaagatatgttg
aagaatatgcttgctgtagcggatgatatagagcatcgttctaacatccaaacgggttct
attttgttagataaaatgaaaatttcaggaaattaa

DBGET integrated database retrieval system