KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06290Help
Entry
CGSHiEE_06290     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K09889  ribosome-associated protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hip03009]
    CGSHiEE_06290
Ribosome biogenesis [BR:hip03009]
 Prokaryotic Type
  Other maturation factors
   CGSHiEE_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF615 EntA_Immun Cnd1
Motif
Other DBs
NCBI-ProteinID: ABQ98607
UniProt: A5UCV6
Position
1247424..1247960
Genome map
AA seq 178 aa AA seqDB search
MAKRKKKEVFDWEDEDQEEIIWVSKSEIKRDAEDLKQLGEKIVNLTKANLAKIPLDESLL
DAIELAQRLQKEARRRQLQYIGKLFRGIDVEPIREALDKIENKHNQQQAMLHKIEKVRDE
LVEKGDVALTDLLNDYPNGDRQQLRNLIRSAQKELEQNKPSKAYREIYQMLKVLMLED
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgtaagaaaaaagaagttttcgattgggaagatgaagatcaagaagaaatt
atttgggtgagtaaaagcgaaatcaaacgcgatgcggaagatttaaaacaacttggcgaa
aagattgtcaatttaaccaaagctaatcttgccaaaatcccacttgatgaatccttactt
gatgccattgaacttgcacagcgtttacaaaaagaagctcgtcgccgtcaattacaatat
atcggcaaattatttcgaggcattgatgttgagcctattcgtgaagccttagataaaatt
gaaaataagcataaccaacaacaagctatgctacataaaatcgaaaaagtgcgcgatgaa
ttggtggaaaaaggcgatgtggctttaacagatttattaaatgattatcctaatggcgat
cgtcagcaactacgcaatctgattcgttctgcacaaaaagaactggagcaaaataaacca
tcgaaagcctatcgagaaatttatcaaatgctcaaggtattaatgttggaagattaa

DBGET integrated database retrieval system