KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06300Help
Entry
CGSHiEE_06300     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K09774  lipopolysaccharide export system protein LptA
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_06300
Transporters [BR:hip02000]
 Other Transporters
  Pores ion channels [TC:1]
   CGSHiEE_06300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OstA
Motif
Other DBs
NCBI-ProteinID: ABQ98609
Position
1248606..1249124
Genome map
AA seq 172 aa AA seqDB search
MKLVSNKILFLATMVLASSSAFALKADVNQPINIVSDNQSLDMEKSVVTFTDNVVITQGS
IVIKANKVVITRPAEKSGKKETVEAFGTPVTFHQQLDNGKPVDGKANKVHYDLGNEFLTL
TNNAELKQLDSKINGNVITYDVKKQQLKANGNGKSRVTTVLIPSQLQQAKGK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagtaagcaataaaattctttttcttgcaacgatggtattagcatcaagttca
gcttttgcattgaaagctgatgttaatcagccgataaatattgtttcggataatcaatcc
ttagatatggaaaaaagtgtagtgacattcacagataatgtggtaattacacaggggtct
attgttatcaaagcaaataaagttgtcatcactcgtcctgctgaaaaatcagggaaaaaa
gaaactgtagaagcattcggcacgccagtcacattccatcaacagttagataatggtaag
ccagtggatggaaaagcaaataaagttcattatgatcttggtaacgaatttttaacatta
actaacaatgccgaattaaagcagcttgatagtaaaattaatggcaatgttattacctat
gatgtgaaaaaacaacaacttaaagctaatggtaatggaaaatcacgggtaacaacagtt
cttattccatctcaattacaacaagctaaagggaagtaa

DBGET integrated database retrieval system