KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06310Help
Entry
CGSHiEE_06310     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K02806  PTS system, nitrogen regulatory IIA component [EC:2.7.1.-]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:hip00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    CGSHiEE_06310
Enzymes [BR:hip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     CGSHiEE_06310
Transporters [BR:hip02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Nitrogen regulatory II component
    CGSHiEE_06310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2
Motif
Other DBs
NCBI-ProteinID: ABQ98611
Position
1249856..1250350
Genome map
AA seq 164 aa AA seqDB search
MKITELLSPENIRQGVSFSSKKRLFESIAHFVEEQILAEQGEQACFECLFEREKLGNSGL
GNGIAMPKAKIPVTVSDKAIAVFMQLDNPIDYDAFDGKPVDLIFALLIPENQCETYIPVL
ASLIEKLTDKNVLKQLRSAKSADEIWQVFEITDQSETTFEEVKE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactgaactattaagccctgagaatattcgtcagggcgttagtttttctagc
aaaaaacgattatttgagtctattgcgcattttgtagaagaacaaatccttgcagaacaa
ggcgaacaagcctgttttgaatgcctttttgaacgcgaaaaactggggaattctggttta
ggaaatgggattgcaatgccaaaagcgaaaatccccgtaacagtatcagataaagcaatc
gcagtgtttatgcaactcgataatccgattgattacgatgcttttgatggtaaaccagtg
gatttaatctttgccttgctgattccagaaaatcaatgtgaaacctacattccagtttta
gcatcattaatagaaaaactgactgataaaaatgtgttgaaacaattacgatcagccaaa
agtgcggatgaaatttggcaagtttttgaaattaccgatcaatcagaaacgacatttgaa
gaagtgaaagaataa

DBGET integrated database retrieval system