KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06320Help
Entry
CGSHiEE_06320     CDS       T00543                                 

Definition
(GenBank) chorismate mutase/prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01130  Biosynthesis of antibiotics
hip01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiEE_06320
Enzymes [BR:hip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     CGSHiEE_06320
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     CGSHiEE_06320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT ANF_receptor
Motif
Other DBs
NCBI-ProteinID: ABQ98613
Position
complement(1251271..1252428)
Genome map
AA seq 385 aa AA seqDB search
MALELSDIRQQITQIDRSLLKLLSERHRLAFDVVRSKEISQKSLRDVEREQQLLQELVQF
AENENYQLEAQYITSIFQKIIEDSVLTQQVYLQNKLNEQRNQNLHIAFLGKRGSYSNLAA
RNYAARYQKQFVELGCQSFEQVFEKVQTGEADFGVLPLENTTSGAINEVYDLLQHTDLSL
VGELAYPIKHCVLVNDKTDLSQIDTLYSHPQVIQQCSQFIHSLDRVHIEYCESSSHAMQL
VASLNKPNIAALGNEDGGKLYGLSVLKTNIANQENNITRFIVVAKEPREVSSQIPTKTLL
LMTTSQQAGALVDALLVFKKHQINMTKLESRPIYGKPWEEMFYLEIEANIHHPDTKQALE
ELKNYSNYLKILGCYPSEIVKPVSV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaattatctgacattcgccaacaaattacgcaaatagatcgtagtttatta
aaattactttctgagcgtcatcgtttagctttcgatgtagtgagaagtaaagagatctcg
caaaaatctttacgtgatgtagagcgagaacagcaacttttacaagaactagtgcaattt
gcagaaaatgaaaattatcagcttgaagcacaatatatcacttcaattttccaaaaaatc
attgaagactcggtattgacccagcaagtctatttgcaaaataaacttaatgaacaacgt
aatcaaaatttacatatcgcttttttaggtaaacgtggttcttattctaatttagctgca
cgtaattatgctgctcgttatcaaaaacaatttgtagaactaggatgtcagtcttttgag
caagtatttgaaaaagttcagactggagaagctgactttggtgtgttacctttagaaaat
acaacatcgggtgcaattaatgaagtttatgatttacttcagcatactgatttatcatta
gtgggagagttggcatatccaatcaaacattgcgtacttgtcaatgataagacagatttg
agccaaattgatacgttgtatagtcatcctcaagtgattcaacaatgtagtcaatttatt
catagccttgatcgcgtgcatattgaatattgcgaaagtagttcacacgcaatgcaatta
gtcgcaagtttgaataaacctaatattgcagcattgggcaatgaagacggtggaaaattg
tatggacttagtgtattaaaaactaatattgctaatcaagagaacaatattacgcgtttt
attgtggtggctaaagagcctcgcgaagtttcatcacagattcccacaaagaccttatta
ttaatgacaacttcacagcaagctggtgcgttagtggatgctttattggtgtttaaaaag
catcaaatcaatatgacaaaactggaatctcgaccgatttatggtaagccttgggaagaa
atgttttatctagaaattgaagcaaatattcatcatccagatacaaaacaggctttggaa
gaactaaaaaattatagtaattacttaaagattttaggctgttatcctagtgaaattgta
aagcctgtgagcgtgtaa

DBGET integrated database retrieval system