KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06325Help
Entry
CGSHiEE_06325     CDS       T00543                                 

Definition
(GenBank) hypothetical protein
  KO
K02535  UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC:3.5.1.108]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00540  Lipopolysaccharide biosynthesis
hip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CGSHiEE_06325
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hip01005]
    CGSHiEE_06325
Enzymes [BR:hip01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.108  UDP-3-O-acyl-N-acetylglucosamine deacetylase
     CGSHiEE_06325
Lipopolysaccharide biosynthesis proteins [BR:hip01005]
 Lipid A
  CGSHiEE_06325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxC Bac_surface_Ag
Motif
Other DBs
NCBI-ProteinID: ABQ98614
UniProt: A5UCW3
Position
complement(1252555..1253472)
Genome map
AA seq 305 aa AA seqDB search
MIKQRTLKQSIKVTGVGLHSGEKVTLTLRPAMPNTGVVYYRTDLNPTVAFPADPNSVRDT
MLCTALINEQGVRISTVEHLNAALAGLGIDNIIIEVDAPEIPIMDGSASPFIYLLLDAGI
EEQNAAKKFIRIKEYVRVEDGDKWAEFKPYNGFRLDFTIDFDHPAIGKDVRNYEMNFSAQ
AFVHQISRARTFGFMKDIEYLQSQGLVLGGSLDNAIVLDDYRILNEDGLRFKDELVRHKM
LDAIGDLYMAGYNIIGDFKAYKSGHGLNNKLLRAVLANQEAWEFVTFEDKEQVPQGYVAP
AQVLI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaaagaacattaaaacaaagtattaaagttacaggcgttggcttgcatagc
ggtgaaaaagtgacattaaccttgcgcccagctatgccaaacactggtgttgtttattat
cgtacagatttaaaccctacggtggcattccctgctgatcctaattcagtgcgtgataca
atgctttgtaccgcactaattaatgaacaaggtgtgcgtatttctaccgtcgagcattta
aatgcagctttggcagggcttgggattgataatattattattgaagttgatgctcctgaa
attccaattatggatggtagtgctagtccgtttatctatttgttgttagatgcgggaatt
gaagaacaaaatgcagcgaaaaaatttattcgtattaaggaatatgttcgagttgaagat
ggcgataaatgggctgaatttaagccttacaatggttttcgtttagattttactattgat
tttgaccatcctgctattggcaaagatgtacgtaactatgaaatgaatttttctgcccaa
gcatttgttcatcaaattagccgagcaagaacttttggctttatgaaagatattgaatat
cttcaatctcaaggtttagtattaggtggtagccttgataatgcgattgttcttgatgat
tatagaattttaaatgaagatggtttacgttttaaagatgaacttgttcgtcataaaatg
ttagatgcaattggtgatctttatatggctggttataacattatcggtgattttaaagcc
tataaatcaggtcacggtttaaataacaagttacttcgtgctgttttagcaaatcaagaa
gcgtgggaatttgtaacctttgaagataaagagcaagtgccacaagggtatgtagctcca
gcgcaagtgcttatttaa

DBGET integrated database retrieval system