KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06330Help
Entry
CGSHiEE_06330     CDS       T00543                                 

Definition
(GenBank) cell division protein FtsZ
  KO
K03531  cell division protein FtsZ
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hip03036]
    CGSHiEE_06330
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hip04812]
    CGSHiEE_06330
   02048 Prokaryotic Defense System [BR:hip02048]
    CGSHiEE_06330
Chromosome and associated proteins [BR:hip03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CGSHiEE_06330
Cytoskeleton proteins [BR:hip04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   CGSHiEE_06330
Prokaryotic defense system [BR:hip02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    CGSHiEE_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin FtsZ_C Tubulin_2 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ABQ98615
Position
complement(1253511..1254776)
Genome map
AA seq 421 aa AA seqDB search
MLYPEYPEYDNFNESGALIKVVGVGGGGGNAVNHMVMNMVKQEMGGTFVGESSLTSEEHG
RIVFYAVNTDAQALRKSQVQQTVQIGGETTKGLGAGANPNIGRKAAEDDQDEIRKMLEGA
DMVFIAAGMGGGTGTGAAPVVAKIAKELGILTVAVVTKPFAFEGKKRMQFAELGIKDLSQ
YVDSMIIIPNQQIQKVLPKNAKLIDAFAAANDVLRNSVMGISDMITSPGLINVDFADVRT
VMSVQGQAMIGFGSAVGEPGAGRAEEAARLAVRNDLLEKIDLSNAQGILVNITAGMDLVF
EEFNIIGETIGSFASEEATVVVGTSLVPEMSDEIRVTIVATGLGEIAGNEPIQVVRQGLS
TQNIEGEGRVNIVPELHRRESVEVSRTASEEYQRPLDKPITDRLEAFKKNNFFNPAQREE
N
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgctatacccagagtaccctgagtacgataattttaacgaatccggcgcactgatcaaa
gtcgtaggtgtaggcggtggcggtggcaatgccgtaaaccatatggtaatgaatatggta
aaacaagaaatgggcggaacctttgttggcgaaagttcattaacatcagaggaacacggt
cgcatagtattttatgccgtcaatactgatgctcaagcattgcgtaaaagtcaagttcaa
cagaccgtacaaattggtggagaaacaaccaaaggtttaggtgctggggcaaatccgaat
attggtcgtaaggcagctgaagatgatcaggatgaaatccgcaaaatgcttgaaggtgcc
gatatggtctttattgcagcaggtatgggcggcggcacaggtacgggtgcggcacctgtt
gttgctaaaattgctaaagaactcggtattttgactgttgctgtagtgactaaacctttt
gcctttgaaggcaaaaaacgtatgcaatttgcagagcttggtattaaagatttatcccaa
tatgttgattcaatgattattattccgaatcaacaaatccaaaaagttctccctaaaaat
gctaaattaattgatgcttttgctgctgcaaacgacgtattgcgtaattctgtaatggga
atttcagatatgattacctctcctggtttaattaacgtggacttcgctgatgtaagaacg
gtaatgtcagttcaagggcaagctatgattggttttggttcagctgtgggagaacccggt
gcaggtagagcagaagaggcagctcgtcttgcagtacgcaatgatcttctagaaaaaatc
gatctttctaacgctcaaggaattttagttaatattactgctggaatggatttagttttt
gaagagtttaacattataggtgagacaataggtagttttgcttctgaagaagcgacagtt
gttgttggtacgagtttagtgcctgagatgagcgatgaaattcgtgtaactattgtggca
actggtctcggtgaaattgcaggaaatgaaccaattcaggttgttcgtcaagggctttct
acgcagaatattgaaggtgaaggacgtgtaaacattgttcctgaacttcatcgtcgtgaa
tctgttgaagtgtcaagaactgcatcagaagaatatcaacggccgttagataaaccgatt
acagatcgcttggaagcatttaagaaaaataatttctttaatcctgcacagcgtgaagaa
aattaa

DBGET integrated database retrieval system