KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06365Help
Entry
CGSHiEE_06365     CDS       T00543                                 

Gene name
murG
Definition
(GenBank) N-acetylglucosaminyl transferase
  KO
K03588  cell division protein FtsW
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hip03036]
    CGSHiEE_06365 (murG)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_06365 (murG)
Chromosome and associated proteins [BR:hip03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CGSHiEE_06365 (murG)
Transporters [BR:hip02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   CGSHiEE_06365 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID: ABQ98620
Position
complement(1260545..1261729)
Genome map
AA seq 394 aa AA seqDB search
MEFLQNIKKNYDEWTRITPQGLLYDRALFWLFVILLLIGLVAVTSASIPYSSRLFNDPFY
FAKRDAIYVLLSLLTCYISLHISSSQWEKWHAKIFLFSVILLLLVPFIGTSVNGAKRWIS
LGILNFQPAEFAKLALTCFLASYFTRRYDEVRSRHVSIFKPLIVMLVLGCFLLLQPDLGS
TVVLFIIMSGMLFIVGAKILQFVGLIALGGILFVWLVLTASYRLKRFTGFLEPFKDPYGT
GFQLTNSLMAFGRGEITGEGLGNSIQKLDYLPEAHTDFIMAIIGEEFGFIGIFIVILLLG
LLIFRAMKIGRESLMLEQRFRGFFALGIGFWIFFQGFVNLGMALGMLPTKGLTFPLVSYG
GSSIIIMSATIGILLRIDHENRLFRIGQARLRDD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaatttttacaaaatatcaaaaaaaattacgatgaatggacacgcatcacacctcaa
ggtttgttgtatgatcgcgcactattttggttatttgttattttgcttttaattggttta
gtggcagtaacatctgcttctattccttatagctctcgtttatttaatgatcctttttac
tttgcaaaacgcgatgctatttatgtgctactttctttgctaacttgttatatttcatta
catatttcttcttcgcaatgggaaaaatggcacgctaaaattttcttattttccgtcata
ttattattgcttgttccttttattggtacatcggttaatggtgcaaaacgttggatttca
ttggggatcttaaactttcaacctgcagaatttgcaaaattagcactcacttgtttttta
gcaagctattttactcgtcgttatgatgaagtgcggtcacgacatgttagtatttttaaa
ccgcttattgttatgcttgtattaggttgttttcttttattacaacctgatttaggtagt
acagtcgtgctatttattattatgtcaggaatgctttttatcgtgggggcaaaaatttta
cagtttgtaggattaatcgctctaggaggcattttattcgtttggcttgtattgacagct
tcttatcgcctcaagcgatttacaggttttttagagccctttaaagatccttatggtacg
ggatttcaactaacaaattctcttatggcgtttggtcgaggagaaattactggagaagga
ttaggtaattcaattcaaaaattagattatctgcctgaagcacataccgatttcattatg
gcgattatcggcgaagaatttggatttatcggtatatttattgttattcttttattaggt
ttattaatttttcgtgcaatgaaaattggacgagaatccttaatgttagaacaacgtttt
cgaggtttttttgcattaggtattggtttttggattttctttcaaggctttgttaattta
ggtatggcgcttggaatgttaccaactaaaggtttaacctttccactcgtgagttatggt
ggttcgagtattatcattatgtccgccaccattggtattttattgcgaattgatcacgaa
aatcgtttatttcgtataggtcaagcacgcttgcgtgatgattag

DBGET integrated database retrieval system