KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06375Help
Entry
CGSHiEE_06375     CDS       T00543                                 

Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00550  Peptidoglycan biosynthesis
hip01100  Metabolic pathways
hip01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGSHiEE_06375
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    CGSHiEE_06375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hip01011]
    CGSHiEE_06375
Enzymes [BR:hip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     CGSHiEE_06375
Peptidoglycan biosynthesis and degradation proteins [BR:hip01011]
 Precursor biosynthesis
  Glycosyltransferase
   CGSHiEE_06375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 MraY_sig1
Motif
Other DBs
NCBI-ProteinID: ABQ98622
UniProt: A5UCX1
Position
complement(1263176..1264258)
Genome map
AA seq 360 aa AA seqDB search
MLVWLAEYLVRYETAFNAISYITVRAILTLLTALFISLWIGPKVIKRLQILKFGQEVRND
GPESHFAKKGTPTMGGVMILFSIGVSTLLWANLANPYIWVCLFVLFGYGAIGFVDDFRKI
TRKNTDGLIARWKYFWMSVVALVAILWLYWLGHDTDATRLVIPFFKDIMPQLGLFYIVLS
YFVIVGTGNAVNLTDGLDGLAIMPTALVAGAFALIAWATGNVNFAEYLHIPYIKYSSEVV
VFCTAIVGASLGFLWFNTYPAQVFMGDVGSLALGGALGVVAILVRQEFLLVIMGGVFVVE
ALSVILQVGSYKLRKQRIFRMAPIHHHFELKGWPEPRVIIRFWIISLMLVLMGLVTLKLR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgttagtctggcttgctgaatatcttgttcgttacgaaaccgcctttaatgcgatttct
tatattaccgtccgcgcaattcttacattattaaccgcactttttatctcactttggatt
ggccctaaagtgatcaaacgtttacagatcttaaaatttggccaagaagtgcgaaatgat
ggccctgaaagtcactttgcaaaaaaaggcacacccactatgggcggtgtgatgatttta
ttctctattggcgtaagtacgttattatgggcaaatcttgctaatccttatatttgggtt
tgtttatttgttttatttggatacggtgcaattggttttgtggatgatttccgtaaaatt
acccgtaaaaatactgatggattgattgctcgttggaaatatttctggatgtctgtggtg
gcattagtggcaatcctttggctttattggcttggtcacgacactgatgccacccgttta
gtgattccattctttaaagacattatgcctcaattaggtttgttctatattgtgttatct
tactttgtgattgttggcacgggtaatgcagtgaatttaaccgacggtttagatggatta
gcgattatgcctactgcgcttgttgcaggtgcgtttgctttaattgcttgggctacaggt
aacgtgaatttcgcagaatatttgcacattccgtatattaaatacagttctgaagtagtg
gtgttctgtacagctattgttggcgcgagtttaggatttttatggtttaatacttatcca
gctcaagtatttatgggggacgtgggttctctagcattaggtggtgcgctgggtgtcgta
gcaattcttgttcgtcaggaatttttgcttgtgataatgggtggtgtatttgttgttgaa
gcactctctgttattttgcaagtagggtcttataagttacgcaaacaacgcatttttaga
atggcaccgattcaccaccattttgaattgaagggatggcctgagccaagagtgattatt
cggttttggattatttccttaatgttagtgttgatgggattagtcaccttgaagttgcgt
taa

DBGET integrated database retrieval system