KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06380Help
Entry
CGSHiEE_06380     CDS       T00543                                 

Gene name
mraY
Definition
(GenBank) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01929  UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00300  Lysine biosynthesis
hip00550  Peptidoglycan biosynthesis
hip01100  Metabolic pathways
hip01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CGSHiEE_06380 (mraY)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGSHiEE_06380 (mraY)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CGSHiEE_06380 (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hip01011]
    CGSHiEE_06380 (mraY)
Enzymes [BR:hip01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     CGSHiEE_06380 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:hip01011]
 Precursor biosynthesis
  Amino acid ligase
   CGSHiEE_06380 (mraY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ABQ98623
Position
complement(1264252..1265625)
Genome map
AA seq 457 aa AA seqDB search
MIKLSTVQLAQILQAKLIGDENVQVEEINTDTRKSVSNSLFFALKGEKFDAHQYLEQAVA
QGSVAVVVQQENSSILVPQLVVKDTRIALGELAKWLREKINPRTVAMTGSSGKTTVKEMT
ASILQHTAADSEAVLFTNGNFNNDIGVPLTLLRLTEKHRFAVIELGANHQNEINYTTKLV
QPNAALINNIAPAHLEGFGSLAGVVQAKGEIYRGLTKNGVAIINAEHNHLDIWQKEISNH
AIQYFNGKDYSVKNVQGNEQGSTFTLVSPQGEIDISLPYLGEHNIKNALAATALAMNVGA
TLADVKAGLEQRSQVKGRLFPIQVTPNLLLLDDTYNANKDSLCAAIDVLKSYDAFLILCV
ADMKELGENSLAIHREVGQYINLVNLDLVCSYGNESAVISEAVSGKHFTDKTEMVDFLVP
LIENQLQQNKKVVVLGKGSRSMKMEDVIYSLKDKIKC
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactctctactgtacaacttgcacagattcttcaagctaaattaattggcgat
gaaaatgtgcaagttgaagaaattaatacggatactcgaaaaagcgtatcaaatagttta
ttttttgctttaaaaggcgaaaaatttgatgctcatcaatatcttgaacaagcggtagca
caaggttcggtagccgttgttgttcagcaagaaaactcgtctattttagttcctcaactt
gtggttaaagacactcgtattgctttgggcgagcttgcaaaatggttacgtgagaaaatt
aatccacgtactgtggcgatgaccggctcttctggtaaaactacggtaaaagaaatgaca
gcaagtattttgcagcataccgcagctgattcagaagcggtactttttaccaatggtaac
ttcaataacgatataggtgtgcctttaactctgcttcgcttaacagaaaaacatcgtttt
gctgtgattgaacttggtgcaaatcatcaaaatgaaatcaattacaccacaaaattagtt
caacctaatgccgcattgattaataatattgcgcccgcacatttagaggggtttggttct
ttagcgggggttgttcaagcaaaaggcgagatttatcgaggtttaacaaaaaatggtgtg
gcgattatcaatgctgaacataatcacttagatatttggcaaaaagaaatcagcaatcac
gccattcaatatttcaacggcaaggattattccgtcaaaaatgttcaaggtaacgaacaa
ggttcaacctttacgttagtttctccgcaaggcgaaattgatattagtttgccttatctt
ggagagcataatataaaaaatgctttagctgctaccgcactagcgatgaatgttggtgct
acgcttgccgatgtcaaagctggattagaacaacgttcacaagtgaaagggcgtttattt
cctattcaagtaacgcctaatttattgttattagatgatacttataacgcaaataaagat
tctctctgtgcggctattgatgtcctaaaaagttatgatgctttccttattctatgtgtc
gcagatatgaaagaattgggcgaaaattctctcgctattcatcgtgaagttggacaatat
attaatttggtaaatttagatttagtgtgttcttatggcaatgaaagtgcggttatttct
gaggctgtttcgggtaagcattttacggataaaactgaaatggtggatttcttagttcca
cttattgaaaaccaattacaacaaaataaaaaagttgtggtgctaggaaaaggctcacgc
tcaatgaaaatggaagatgtgatctattcattaaaggataaaattaaatgttag

DBGET integrated database retrieval system