KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06390Help
Entry
CGSHiEE_06390     CDS       T00543                                 

Definition
(GenBank) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00550  Peptidoglycan biosynthesis
hip01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CGSHiEE_06390
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    CGSHiEE_06390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hip01011]
    CGSHiEE_06390
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hip03036]
    CGSHiEE_06390
Enzymes [BR:hip01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CGSHiEE_06390
Peptidoglycan biosynthesis and degradation proteins [BR:hip01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CGSHiEE_06390
Chromosome and associated proteins [BR:hip03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CGSHiEE_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Tr-sialidase_C IF2_N
Motif
Other DBs
NCBI-ProteinID: ABQ98625
Position
complement(1267115..1268947)
Genome map
AA seq 610 aa AA seqDB search
MVKFNSSRKSGKSKKTIRKLTAPETVKQNKSQKVFEKCFMRGRYMLSTVLILLGLCALVA
RAAYVQSINADTLSNEADKRSLRKDEVLSVRGSILDRNGQLLSVSVPMSAIVADPKTMLK
ENSLADKERIAALAEELGMTENDLVKKIEKNSKSGYLYLARQVELSKANYIRRLKIKGII
LETEHRRFYPRVEEAAHVVGYTDIDGNGIEGIEKSFNSLLVGKDGSRTVRKDKRGNIVAH
ISDEKKYDAQDVTLSIDEKLQSMVYREIKKAVSENNAESGTAVLVDVRTGEVLAMATAPS
YNPNNRVGVKSELMRNRAITDTFEPGSTVKPFVVLTALQRGVVKRDEIINTTSFKLSGKE
IVDVAPRAQQTLDEILMNSSNRGVSRLALRMPPSALMETYQNAGLSKPTDLGLIGEQVGI
LNANRKRWADIERATVAYGYGITATPLQIARAYATLGSFGVYRPLSITKVDPPVIGKRVF
SEKITKDIVEILEKVAIKNKRAMVEGYRVGVKTGTARKIENGHYVKKYVSFTAGIAPISD
PRYALVVLINDPKAGEYYGGAVSAPVFSNIMGYALRANAIPQDAEAAENTTTKSAKRIVY
IGEHKNQKVN
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaatttaattcctcgcgtaaatcaggtaagtcaaaaaaaacaattagaaaattg
accgcacctgaaactgtaaagcaaaacaagtctcaaaaggtgtttgaaaaatgctttatg
cgtgggcgttatatgctttctacggttcttattttacttggcctgtgtgctttagtcgca
cgagcagcttatgttcaatctattaatgccgatacgttatcgaatgaagcggataagcgt
tctttgcgtaaagatgaagtattatcggtgcgtggttctattttagatcgtaatggtcag
cttttatctgtaagcgtgccgatgagcgcgattgtggcagatccaaaaacgatgttgaag
gaaaattcgcttgcggataaagaacgaattgcagctttagccgaagaattaggtatgact
gaaaatgatttagtgaaaaaaattgagaaaaattctaaatctggttatttgtatttagca
cgtcaagttgaattaagtaaagctaactatattcgtagattaaaaattaagggtattatt
ttagaaacagagcatcgccgtttttatcctcgtgtagaagaagctgcacacgtggtgggt
tatacggatattgatggaaatggtattgaaggcattgagaaaagttttaattccctgctt
gttggtaaagacggttcacgtactgttcgtaaagataaacgtgggaatattgttgcacat
atctccgatgagaaaaaatatgatgcacaagatgttaccttaagtatcgatgaaaaattg
caatctatggtgtatcgtgagattaaaaaggcggtgtctgagaataatgcggagtctggt
actgcggtgttagttgatgttcgaacaggggaagtgttagctatggcgactgctccctct
tataatccaaacaaccgtgtcggtgtgaaatcagagttaatgcgtaaccgtgcaattacc
gatacttttgagccaggttctacggtaaaacctttcgttgttttaaccgcacttcaacga
ggtgtcgttaaacgagatgaaattattaataccacgtcctttaaattaagcggtaaagaa
attgtggatgttgcaccacgtgctcaacaaactttagacgagattttaatgaactctagt
aaccgtggtgtaagtcgtcttgcattgcgtatgccacctagtgcattaatggaaacttat
cagaatgcaggtttaagtaaaccgacagatttaggcttgatcggcgaacaagtcgggatt
ttgaacgcaaaccgtaaacgctgggcagatattgaacgtgcaacagttgcttatggttat
ggtattactgcgacacctttacaaattgctcgagcctatgcaacccttggtagttttggt
gtttatcgcccgctttctatcactaaagtcgatccgccagtcattggaaaacgtgttttc
tctgaaaaaataaccaaagatatcgtggagattttagagaaagtagcaattaaaaataaa
cgcgctatggtggaaggctaccgtgttggcgtgaaaacgggtacggcacgtaagattgaa
aatggtcactatgtgaagaaatatgtgtcattcactgcgggtattgcaccaattagtgat
cctcgttatgcattagtggttttgatcaatgatccaaaagcaggagaatattatggtggt
gcggtttctgcccctgtattctctaacattatgggctatgcgttacgtgcaaatgctatt
ccgcaagatgctgaagcggctgaaaacacaacaacgaaaagtgcaaaacgtattgtttat
attggcgaacacaagaatcaaaaagtgaattaa

DBGET integrated database retrieval system