KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06400Help
Entry
CGSHiEE_06400     CDS       T00543                                 

Gene name
mraW
Definition
(GenBank) S-adenosyl-methyltransferase MraW
  KO
K03438  16S rRNA (cytosine1402-N4)-methyltransferase [EC:2.1.1.199]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hip03009]
    CGSHiEE_06400 (mraW)
Enzymes [BR:hip01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.199  16S rRNA (cytosine1402-N4)-methyltransferase
     CGSHiEE_06400 (mraW)
Ribosome biogenesis [BR:hip03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    CGSHiEE_06400 (mraW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_5 Methyltransf_31 Methyltransf_25 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: ABQ98627
UniProt: A5UCX6
Position
complement(1269285..1270250)
Genome map
AA seq 321 aa AA seqDB search
MNSENSFSSSEHITVLLHEAVNGLALKENGIYIDGTFGRGGHSRFILSQLSSNGRLIAVD
RDPRAIAEAHKIQDLRFQIEHNSFSHIPEICDKLNLVGKIDGILLDLGVSSPQLDEAERG
FSFMKDGPLDMRMDTTQGLSAEEWLKQVSIEDLTWVLKTFGEERFAKRIATAIVDFNKSA
VKNSTEFLSRTSQLAELISQAVPFKDKHKHPATRSFQAIRIFINSELDELESLLNSALDM
LAPEGRLSIISFHSLEDRMVKHFMKKQSKGEDIPKGLPLREDQIQRNQKLRIIGKAIQPS
DAEIQANPRSRSAILRVAERI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcgaaaattccttttcttcatctgaacatattacagttttacttcacgaagcc
gtgaatggcttggcattgaaggagaatggcatttatattgatggtacttttgggcgtggg
gggcattctcggtttatcctttctcaactttcttctaatggtcgtttgatagctgtagat
cgcgatcctcgtgctattgcagaagcacacaaaatccaagacttgcgttttcagattgaa
cataacagcttttcgcatattcctgaaatttgtgacaaattaaatttagtgggcaaaatt
gacggtattttgcttgatcttggtgtgtcttcccctcagcttgatgaagcagaacgtggt
tttagttttatgaaagatggcccgcttgatatgcgtatggatacaactcaaggtttatct
gctgaagaatggttaaaacaagtgtccattgaggatttaacttgggtgttgaaaactttt
ggcgaagagcgtttcgctaaacgtattgccactgctattgttgatttcaataaaagtgcg
gtaaaaaatagcacagaatttttatcgcgtaccagtcaattggcggaacttatttcacag
gcagttccttttaaagataaacataaacatcctgcgacgcgtagtttccaagctattcgt
atttttattaattcggaattagatgaattagaaagtttgcttaattctgcgttagatatg
ttagcaccagaaggtcgtttatcaattattagtttccattctttagaagatagaatggtg
aaacattttatgaaaaaacaaagtaagggcgaggatattcccaaaggtttaccattgcga
gaagatcaaattcagcgtaatcaaaaattaagaattattggtaaagccattcagccaagt
gatgcagaaattcaagcaaatcctcgttcaagaagtgccatattacgtgtggcagagaga
atttag

DBGET integrated database retrieval system