KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06430Help
Entry
CGSHiEE_06430     CDS       T00543                                 

Definition
(GenBank) oligopeptide permease ABC transporter membrane component
  KO
K15581  oligopeptide transport system permease protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip01501  beta-Lactam resistance
hip02010  ABC transporters
hip02024  Quorum sensing
Module
hip_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CGSHiEE_06430
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CGSHiEE_06430
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01501 beta-Lactam resistance
    CGSHiEE_06430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_06430
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    CGSHiEE_06430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABQ98633
Position
1276567..1277487
Genome map
AA seq 306 aa AA seqDB search
MLKFIFKRLLEALPTLFILITFSFFLMRLAPGSPFTSERAYPPEVMANIEAKYHLNEPLY
KQYFLYLENLSKGDFGPSFKYKDQSVNDLIASAFPVSIKLGMVAFAFAVVLGVTAGTLAA
LNQNSRWDYILMSFSMLGVIMPSFVFAPILVLIFAIYLGWLPAGGWNGGTAIYMILPVAS
LTIAYVAGIARIMRGSMIEVLHSNFIRTAKAKGLSMSRIILKHALRPALLPVITYLGPAF
VGIITGSMVIESVFGLPGMGLLFVNGALNRDYSLVLSLTILVGTLTILFNAIVDILYAII
DPKIRY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtttatttttaaacggctgttggaagccttgccaacgctgtttattttaatt
actttttctttctttttgatgcgtcttgcccctggcagcccgttcacttctgaacgcgct
tatccgccagaagtcatggctaatatcgaagcgaagtatcatttaaatgaaccattatat
aaacaatatttcctttatttagaaaatctttccaaaggagattttggtccctcttttaaa
tataaagaccaatcagtcaatgatttaatcgcgtcagctttccctgtttccataaaattg
ggcatggtggccttcgcctttgcagtcgtgctaggagtaacagcaggtacgctcgccgct
ctgaatcaaaatagccgttgggattatattttgatgagtttctcgatgcttggggtcatt
atgccaagcttcgtatttgcacctattttagtgctaattttcgccatttatctaggatgg
ctgccagctggcggttggaacggcggtaccgccatatacatgatcttacctgtagcctcc
ttaactatcgcttatgttgcagggattgcgcgtatcatgcgtggttcgatgattgaagtg
ttacattccaactttattcgaaccgccaaagctaaaggactttccatgtcgagaatcatt
ttaaaacatgctttgcgtcccgcacttttacccgtgataacctatttaggacctgctttc
gtagggattattaccggctcaatggtcatcgaaagcgtatttggtttacctggcatggga
ttattatttgtaaacggcgcattgaaccgcgattactctttagttttgagcctcaccatt
ttagtggggacattaaccattttatttaatgcgattgtggatattttatacgccatcatc
gatccaaaaattcgttattaa

DBGET integrated database retrieval system