KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06445Help
Entry
CGSHiEE_06445     CDS       T00543                                 

Definition
(GenBank) oligopeptide transport ATP-binding protein
  KO
K10823  oligopeptide transport system ATP-binding protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip01501  beta-Lactam resistance
hip02010  ABC transporters
hip02024  Quorum sensing
Module
hip_M00439  Oligopeptide transport system
Brite
KEGG Orthology (KO) [BR:hip00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CGSHiEE_06445
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CGSHiEE_06445
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01501 beta-Lactam resistance
    CGSHiEE_06445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_06445
Transporters [BR:hip02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Oligopeptide transporter [MD:M00439]
    CGSHiEE_06445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_22 RsgA_GTPase TniB AAA_21 AAA SMC_N AAA_16 AAA_13 NACHT MMR_HSR1 RNA_helicase AAA_29 ATP-synt_ab GlgX_C NB-ARC ATPase_2 PRK Sigma54_activat DUF87
Motif
Other DBs
NCBI-ProteinID: ABQ98636
Position
1279410..1280408
Genome map
AA seq 332 aa AA seqDB search
MTVSNNKELLLEVNHLGVSFKIKNDKSLFFAKPQTLKAVKDVSFKLYAGETLGVVGESGC
GKSTLARAIIGLVEASEGEILWLGKHLRKQSAKQWKETRKDIQMIFQDPLASLNPRMNIG
EIIAEPLKIYQPHLSAAEVKEKVQAMMLKVGLLPNLINRYPHEFSGGQCQRIGIARALII
EPKMIICDEPVSALDVSIQAQVVNLLKSLQKEMGLSLIFIAHDLAVVKHISDRVLVMYLG
NAMELGSDVEVYNDTKHPYTKALMSAVPIPDPKLERNKSIELLEGDLPSPINPPSGCVFR
TRCLKADENCAKQKPPFTSQNNSHFVACLKVL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacagtctcaaacaacaaagaattactccttgaagtcaatcacttaggcgtcagtttt
aaaattaaaaatgataaatcccttttcttcgccaaaccgcaaaccttaaaagcggtgaag
gatgtgtcttttaaactttacgcaggtgaaactctcggcgtagtaggtgaatctggttgt
ggtaaatccacacttgcacgcgctattatcggtttagtcgaagcgagtgaaggggaaatc
ttgtggcttggtaaacatttacgaaaacaatcagcgaaacaatggaaagaaacgcgtaaa
gatattcaaatgattttccaagacccactagcctctctcaatccgcgaatgaatattggc
gaaatcattgctgagccattaaagatctaccaaccgcacttaagtgccgccgaagtgaaa
gaaaaagtgcaagctatgatgttgaaagttgggcttttaccgaacttgattaaccgctac
ccacatgaattttctggtggtcaatgtcagcgtatcggtattgctcgtgcattaatcatt
gagcccaaaatgatcatttgtgatgagcccgtttcagcgttagatgtgtcgattcaggct
caagtggtgaatttattgaaatccctgcaaaaagaaatggggctttccttaatttttatc
gctcatgatttagcggtggtaaaacatatttctgaccgcgtgttggtgatgtatttaggc
aatgcaatggaattaggcagcgatgtggaagtatataacgataccaaacatccttatacc
aaagccttaatgtctgctgttccgatccccgatccaaaattggaacgcaataaatccatc
gaattacttgaaggtgatttgccttcaccaattaatccaccgtctggttgcgtatttcgt
actcgctgtctaaaggctgatgagaattgtgcgaaacaaaaaccacctttcaccagccaa
aacaacagccattttgtggcttgcttgaaagtcttataa

DBGET integrated database retrieval system