KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06465Help
Entry
CGSHiEE_06465     CDS       T00543                                 

Definition
(GenBank) GTPase EngB
  KO
K07391  magnesium chelatase family protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase ChlI Mg_chelatase_C MCM AAA_5 Sigma54_activat AAA_32 AAA RuvB_N Lon_C Parvo_NS1 IstB_IS21 AAA_22 AAA_16 AAA_2 Sigma54_activ_2 AAA_19 AAA_33 T2SSE AAA_11
Motif
Other DBs
NCBI-ProteinID: ABQ98638
Position
1282153..1283682
Genome map
AA seq 509 aa AA seqDB search
MSLAIVYSRASMGVQAPLVTIEVHLSNGKPGFTLVGLPEKTVKEAQDRVRSALMNAQFKY
PAKRITVNLAPADLPKEGGRFDLPIAIGILAASDQLDASRLKQFEFVAELALTGQLRGVH
GVIPAILAAQKSKRELIIAKQNANEASLVSDQNTYFAQTLLDVVQFLNGQEKLPLATEIV
KESAVNFSGKNTLDLTDIIGQQHAKRALTIAAAGQHNLLFLGPPGTGKTMLASRLTGLLP
EMTDLEAIETASVTSLVQNELNFHNWKQRPFRAPHHSASMPALVGGGTIPKPGEISLATN
GVLFLDELPEFERKVLDALRQPLESGEIIISRANAKIQFPARFQLVAAMNPSPTGHYTGT
HNRTSPQQIMRYLNRLSGPFLDRFDLSIEVPLLPQGSLQNTGDRGETSVQVREKVLKVRE
IQMERAGKINAYLNSKEIERDCKLNDKDAFFLEKALNKLGLSVRAYHRILKVSRTIADLQ
GEQQISQPHLAEALGYRAMDRLLQKLSNM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttgctattgtttacagccgtgcttctatgggtgtgcaagcaccgctagtcacc
attgaggtgcatttaagcaacggaaaaccaggatttacacttgttggtttgccagaaaaa
accgtgaaagaggcacaagatcgggtgcgtagtgcgttgatgaatgcacaatttaaatac
ccagccaagcgtatcactgtaaatctcgcccctgcggatttaccgaaagaaggcggaaga
tttgatttgcctattgctatcgggattttagctgcatcagatcagcttgatgcaagccgt
ttaaagcaatttgaatttgtggcagagcttgcgctgacgggccaattgcgtggcgtacat
ggtgtgattcccgctattcttgcagcgcaaaagtcaaagcgagagttaattatcgcgaaa
caaaatgctaatgaagcctcgctcgtgtctgatcaaaatacttattttgctcaaacgctt
ttagatgtagtgcaatttctcaatggtcaggaaaaattacccctcgccactgaaattgtg
aaagaaagtgcggtaaatttttcaggtaaaaatacgttagatttaacggatattatcgga
caacagcacgctaaacgagcattgaccattgccgcagcggggcagcataatttgctcttt
cttggcccaccgggtacagggaaaaccatgttagccagccgtttgacagggcttttacct
gaaatgacagatctagaagcgatagaaacagcatctgtaacgagtttagttcaaaacgag
ttaaattttcataattggaagcaacgtccttttcgcgccccacatcatagtgcatcaatg
ccggctttagttggtggcggaacgatccctaaacctggcgaaatatccttagcaacaaat
ggggtgctttttcttgatgaacttccagaatttgagcgaaaagtgttagatgcactacgc
cagcctttggaaagtggtgagattattatttctcgtgccaatgcaaaaattcaattccca
gctcgttttcaattagtggcagcgatgaatccaagccctacaggccattatactgggaca
cataaccgcacttcaccacagcaaattatgcgttatttgaatcgactttcagggccattt
ttagatcgttttgatttatctattgaagtgcctttactgccacaaggtagcttgcaaaat
acgggcgatcgtggcgaaaccagcgtgcaagttcgtgaaaaagtgttaaaagtacgtgag
attcaaatggaaagagcggggaaaatcaacgcttatttgaacagtaaagagattgagcgt
gattgcaagttaaatgataaagatgcctttttccttgaaaaagcactgaataaacttggg
ctttctgtacgggcttatcatcgtattttgaaagtttctcgaaccattgccgatctacaa
ggagaacaacaaatttctcaaccgcacttggcggaggccttgggctatcgagcaatggat
cgtttgctgcagaaattgtcgaatatgtaa

DBGET integrated database retrieval system