KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06480Help
Entry
CGSHiEE_06480     CDS       T00543                                 

Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00540  Lipopolysaccharide biosynthesis
hip01100  Metabolic pathways
Module
hip_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CGSHiEE_06480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hip01005]
    CGSHiEE_06480
Enzymes [BR:hip01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     CGSHiEE_06480
Lipopolysaccharide biosynthesis proteins [BR:hip01005]
 Unusual sugar
  CGSHiEE_06480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ABQ98641
Position
1285109..1285981
Genome map
AA seq 290 aa AA seqDB search
MNDLGRKDILVVDNLKDGTKFANLVDLDIADYCDKEDFIASIIAGDEFGDIDAVFHEGAC
SATTEWDGKYIMHNNYEYSKELLHYCLDREIPFFYASSAATYGDTKVFREEREFEGPLNV
YGYSKFLFDQYVRNILPEAKSPVCGFRYFNVYGPRENHKGSMASVAFHLNNQILKGENPK
LFAGSEGFRRDFVYVGDVAAVNIWCWQNGISGIYNLGTGNAESFRAVADAVVKFHGKGKI
ETIPFPEHLKSRYQEYTQADLTKLRSTGYDKPFKTVAEGVAEYMAWLNRK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgatttagggcgcaaagatattttagtggtggataacttaaaagatggcacgaaa
tttgcaaatttagttgatttagacatcgcagattattgcgataaagaagatttcattgct
tctattattgcgggcgatgaatttggcgatattgatgcggtattccacgagggggcatgt
tctgcgactacggaatgggatggtaaatacattatgcacaacaactacgaatattctaaa
gagttgttgcattattgccttgaccgtgaaattccttttttctatgcctcaagcgcagca
acttatggagacaccaaagtattccgtgaagaacgtgaatttgaaggcccattaaatgtt
tatggctattctaaattcttgttcgatcaatatgtacgcaacattttgccagaagcaaaa
tcgccagtatgtggtttccgttatttcaatgtttacgggccgcgtgaaaatcataaaggt
tctatggcgagtgtggcattccacttgaataaccaaatcttaaaaggcgaaaatccaaaa
ttatttgcaggcagcgaaggattccgccgtgattttgtttatgtgggcgatgtggctgca
gtgaatatttggtgttggcaaaatggtatttcgggtatttacaaccttggtacaggaaat
gcagaaagtttccgtgcggtggctgatgcggtagtgaaattccacggtaaaggcaagatt
gaaaccattccattcccagagcatttgaaatctcgttatcaagaatatactcaagcagat
ttaactaaacttcgctcaacaggctacgataaaccattcaaaacagtcgcggaaggcgtg
gctgaatatatggcgtggttgaatagaaaataa

DBGET integrated database retrieval system