KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_06495Help
Entry
CGSHiEE_06495     CDS       T00543                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00040  Pentose and glucuronate interconversions
hip00051  Fructose and mannose metabolism
hip01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CGSHiEE_06495
   00051 Fructose and mannose metabolism
    CGSHiEE_06495
Enzymes [BR:hip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CGSHiEE_06495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ABQ98644
UniProt: A5UCZ3
Position
complement(1287571..1288890)
Genome map
AA seq 439 aa AA seqDB search
MTTYFDKIEKISFEGEKSTNPFAFKHYDANQVILGKTMAEHLRLAVCYWHTFCWNGNDMF
GLGSLERSWQKNSNLLAGAEQKADIAFEFLNKLGVPYYCFHDVDIAPEGNSVREYVQNFH
HIVDILERKQVETGVKLLWGTANCFTNPRYMSGAATNPNPEVFAWAATQVFNAMNATQRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQMVVEHKHKIGFKGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFQHEIATACALDIFGSIDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKHGGFTTGGFNFDAKIRRQSIDPYDLFYAHIGAI
DVLALSLKRAAKMLQEETLQKIVNERYAGWNSELGQHILQGKTSLETLAQLVQQKDLAPK
PVSGQQEYLENLVNQVIYS
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctatttcgataaaattgaaaaaatctcctttgagggagaaaaatccacaaat
ccttttgctttcaaacattatgatgctaatcaagtaattttaggtaaaactatggctgaa
catttacgtttagcggtgtgttattggcataccttttgctggaatgggaatgatatgttt
gggctaggttctttggagcgaagttggcagaaaaattcaaatttgcttgctggcgcagaa
caaaaagccgatattgcttttgagtttttgaataagttaggcgtgccttattattgtttt
catgatgttgatattgcacctgaaggtaattcagtgcgggaatatgtacaaaattttcat
catattgttgatattttagaacgcaaacaagtagaaacgggtgtaaaactcttatgggga
actgcaaattgttttactaatcctcgttatatgtctggtgcagcaactaatcctaatcct
gaggtttttgcttgggctgcaacacaagtgtttaatgcgatgaatgccactcaacgttta
ggtggagaaaattacgtattatggggtggacgtgagggatatgaaactttattgaatacc
gatttgaaacgtgaacgtgaacaaattggtcgttttatgcaaatggtggtagaacataag
cataaaattgggtttaaaggtacattattaattgagccaaaaccgcaagaaccaactaaa
catcaatatgattatgatgtggcaacagtgtatggtttcctaaaacaatttggtttagaa
aaagaaattaaagttaatattgaagctaaccacgcgacgcttgctggccatacctttcaa
catgaaattgcaacagcttgtgcattagatatttttggctcaattgatgctaatcgtggc
gatccacaattaggctgggataccgaccaattcccaaatagtgttgaagaaaacacgtta
gttatgtatgaaattttaaaacatggtggttttactactggaggttttaattttgatgcg
aaaattcgccgacaaagtattgatccttatgatttattttacgctcatatcggtgcaatt
gatgtattggcattatccttaaaacgtgcagcaaaaatgttacaagaggaaaccttacaa
aaaattgttaatgaacgctatgcaggttggaatagtgaacttggtcagcatattttgcaa
ggtaaaacttcacttgaaacacttgcgcaacttgtccaacaaaaagatttagcgccaaaa
ccagtttcaggtcagcaagaatatttggaaaatttggtaaaccaagttatttatagctaa

DBGET integrated database retrieval system