KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_07510Help
Entry
CGSHiEE_07510     CDS       T00543                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00330  Arginine and proline metabolism
hip00332  Carbapenem biosynthesis
hip01100  Metabolic pathways
hip01130  Biosynthesis of antibiotics
hip01230  Biosynthesis of amino acids
Module
hip_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CGSHiEE_07510
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    CGSHiEE_07510
Enzymes [BR:hip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CGSHiEE_07510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABQ98825
UniProt: A5UDH4
Position
complement(1490240..1491346)
Genome map
AA seq 368 aa AA seqDB search
MNKKTIVVKFGTSTLTQGSPKLNSPHMMEIVRQIAQLHNDGFRIVIVTSGAIAAGRHYLN
HPQLPPTIASKQLLAAVGQSQLIQAWEKLFAIYDIHIGQLLLTRADIEDRERFLNARDTL
HALLDNHIIPVINENDAVATAEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDSDPRK
NPEAKLIPVVEQITDHIRSIAGGSGTNLGTGGMMTKIIAADVATRSGIETIIAPGNRPNV
IADLAYEQNIGTKFIAHQSDRLESRKQWLFAAPSAGIITIDNGAQNAILEQNKSLLPAGI
INVEGRFSRGEVVKIRTQSGKDIALGMPRYNSDALQLIKGRKSADIENVLGYEYGAVAMH
RDDMIILS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaacaatcgttgtgaaattcggtacaagcacgctaactcagggttcgcca
aaactgaattcgccacatatgatggaaatcgttcgtcaaattgcacaactgcataatgat
ggatttcgtatagtgatcgtgacttctggtgcgattgcagcgggtcgccattatttaaat
catcctcaattaccacccactatcgcctcaaagcaactgcttgcagcggttggtcagagc
caattaattcaggcttgggaaaaattatttgctatttatgatatccatatcgggcaactt
ttattaacccgtgcagatattgaagatcgcgaacgttttttaaatgcgcgagatacttta
cacgcacttttagataaccacattattcctgtgattaatgaaaatgatgcggtagcgact
gcggaaattaaagtaggagacaatgacaatttatcggcattagtcgctattcttgtgcaa
gcggaacagctttatttattgactgatcaacaaggtttatttgatagtgatccacgtaaa
aatcctgaagcgaaattaattccagttgtagaacaaatcaccgatcatattcgatcaatt
gcaggaggaagtggtacaaatcttggtactggtggaatgatgaccaaaatcattgctgcc
gatgttgcgactcgctctggaattgaaaccattattgctccaggtaatcgcccaaatgtg
atcgctgatcttgcttatgaacaaaatattggtacaaaatttattgcacaccaatctgat
cgattagaaagccgcaaacaatggcttttcgccgcaccatcggcaggtattattaccatt
gataacggtgcgcaaaatgccattcttgaacaaaataaatctttattacccgctggtatt
attaacgtggaagggcgtttttcgcgtggtgaagtagtcaaaatacgcactcaatcaggt
aaagacattgcgctgggtatgccacgctataacagcgatgccctacaattaattaagggc
agaaaatcagcagacattgagaatgttttaggctatgaatatggtgcggtggcaatgcat
cgtgatgatatgattattttgtcataa

DBGET integrated database retrieval system