KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_08705Help
Entry
CGSHiEE_08705     CDS       T00543                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00010  Glycolysis / Gluconeogenesis
hip00051  Fructose and mannose metabolism
hip00562  Inositol phosphate metabolism
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01120  Microbial metabolism in diverse environments
hip01130  Biosynthesis of antibiotics
hip01200  Carbon metabolism
hip01230  Biosynthesis of amino acids
Module
hip_M00002  Glycolysis, core module involving three-carbon compounds
hip_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiEE_08705
   00051 Fructose and mannose metabolism
    CGSHiEE_08705
   00562 Inositol phosphate metabolism
    CGSHiEE_08705
Enzymes [BR:hip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CGSHiEE_08705
Exosome [BR:hip04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CGSHiEE_08705
  Exosomal proteins of bladder cancer cells
   CGSHiEE_08705
  Exosomal proteins of melanoma cells
   CGSHiEE_08705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABQ99040
UniProt: A5UE39
Position
complement(1722172..1722963)
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPVMYLGTAEAALSGCGC
NCGGKSVIQLGAQNVDINVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAAKSQAVAEQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAAAAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacg
aaagaattaatcgagggattaaaagcggaattacatgatgtaacaggttgtgatgtagca
attgcccctcccgttatgtatttaggtacggctgaagctgcactttctggttgtggttgc
aactgtggcggtaaaagtgtgattcaattaggtgcacaaaacgtagatatcaatgtgaaa
ggtgcatttactggtgatatttcaactgaaatgttaaaagatttcggtgcaaaatatatc
attattggccactctgaacgccgcacttatcataaagaaagcgacgaatttgtggcgaaa
aaatttggtgcattaaaagaagctggtttagtgccagtattatgtattggtgaatctgaa
gcagaaaatgaagcaggcaaaactgaagaagtatgtgcacgtcaaattgatgcagtcatc
aatgcattaggcgtagaagcattcaacggtgcagtgatcgcatacgaaccaatctgggcg
attggcacgggtaaatctgcgactccagcacaagcacaagcagttcacgcatttatccgc
ggtcacatcgcggcgaaatcacaagccgtggcagagcaagtaattattcaatacggcggt
tctgtaaatgatgcaaatgccgctgaattatttactcagccagacattgatggcgcatta
gtgggtggcgcatcattaaaagcccctgcatttgcagtaattgttaaagcagcagctgca
gcgaaaaactaa

DBGET integrated database retrieval system