KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_00715Help
Entry
CGSHiGG_00715     CDS       T00544                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01130  Biosynthesis of antibiotics
hiq01230  Biosynthesis of amino acids
Module
hiq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiGG_00715
Enzymes [BR:hiq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CGSHiGG_00715
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CGSHiGG_00715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C TMP-TENI
Motif
Other DBs
NCBI-ProteinID: ABQ99242
UniProt: A5UEN7
Position
135208..136638
Genome map
AA seq 476 aa AA seqDB search
MITQDFTKPIDSATVLQKIVLDKAQWVKAKETEFPLSQFKEKIQQSDRSFYDTLAKGTHQ
KPAYILECKKASPSKGLIRAEFNLEEIANVYKHYASAVSVLTDEKYFQGNFEFLPLVRDI
VSQPVLCKDFMISEYQVYLARYYQADAILLMLSVVNDETYRVLAELAHSLGMGVLTETSN
EDEFERALALGAKIIGVNNRNLHDLTVDLNRVVELTKKYADCIPANVRIISESGIYNHKQ
IHQLQKVAHGFLIGSSLMGNQDLNNAVRSVIFGENKVCGLTRAQDVKIVYENGALYGGLI
FAEHSKRCVSLRQAQELVTAAPLRFVGVFQNQEIDFIVKIANQLQLYAVQLHGAETEAFI
TALRQQLPKNTQIWKAISVNTEAQSAVDFTDDLNVDRYIFDSQTANQQGGTGKTFDWSLI
PENLKYKIILAGGISPNNVEQAIAQGCLGLDLNSGVESSAGVKDQEKVRLVFNNIY
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatcactcaagattttactaaacccattgattccgctacggtgctacaaaaaatcgtg
cttgataaagcgcaatgggttaaagcaaaggaaactgaatttccgctttcacaatttaaa
gaaaagattcaacaatctgaccgctctttttatgatacgttagcaaaaggcacgcatcaa
aagcccgcttacattttggaatgtaaaaaagcctccccttctaagggattaattcgtgct
gaatttaatttggaagaaatcgccaatgtctataaacattatgcctctgctgtatctgtg
ctaactgacgaaaaatactttcaagggaattttgaatttttgcctttagttcgcgatatc
gtaagccaacctgtgctttgcaaagattttatgattagcgaatatcaagtttaccttgct
cgctactatcaagcggatgcaattttattaatgctttctgtggtaaacgatgagacttat
cgtgtgctggcagagcttgcacattctcttggtatgggtgtattgacagaaaccagcaat
gaagatgaatttgaacgtgcccttgcgcttggtgcgaaaattattggtgttaataatcgt
aacttgcacgatttaacagtggatttaaatcgtgttgttgaactcactaaaaaatacgcc
gactgtattcctgctaatgtacgtattattagcgaatcaggcatttacaatcacaagcaa
attcatcaattacaaaaagtggcacatggtttcttaattgggagtagtttaatgggcaac
caagatttgaataatgcggttcgctcggtaatttttggagaaaataaagtatgcggttta
acgcgcgcgcaagatgtcaaaatcgtttacgaaaacggcgcactctacggcggattaatc
ttcgcagaacattcaaaacgctgtgtgagtttacgccaagcgcaagaattagtaaccgct
gctccacttcgatttgttggtgtttttcagaatcaagaaattgactttatcgtcaaaata
gccaaccagttgcagctttatgcggtgcaattacatggtgcagaaactgaagcatttatt
accgcacttcgccagcaattaccaaaaaacacgcaaatctggaaagcgatttcggtcaat
actgaagcccaaagtgcggtcgattttacagatgatttgaatgtggatcgttatattttt
gatagccaaacagcgaaccaacaaggtggtacgggtaaaacctttgattggtcattaatt
cctgaaaatcttaaatataagattattttagctggtggtatctcaccaaacaatgtagaa
caagccattgcgcaaggttgcttaggtttagatcttaattctggggtggaaagttctgcg
ggcgtaaaagatcaagaaaaagtgcggttagtttttaataatatttattaa

DBGET integrated database retrieval system