KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01030Help
Entry
CGSHiGG_01030     CDS       T00544                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00260  Glycine, serine and threonine metabolism
hiq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01130  Biosynthesis of antibiotics
hiq01230  Biosynthesis of amino acids
Module
hiq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiGG_01030
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiGG_01030
Enzymes [BR:hiq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CGSHiGG_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABQ99301
UniProt: A5UEU6
Position
178395..179201
Genome map
AA seq 268 aa AA seqDB search
MSRFETQFATLNAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSSEDSFKLLEKVRSKYPEIPISLLLCANLIFAKGLDAFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGIQPVFICPPNADEKTIQGVAENSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHNAPPILQGFGIAQPEQVKEALSLGTAGAISGSATVK
IIERNLDNHEQCLAELAEFVQTMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaatttgcgacacttaacgcaaaaaatgaaggggctttcgtg
ccgttcgttaccctttgcgaccctactttcgaccgctcttttgagatcatttgcacactt
gtggataacggtgcagatgctttagaactcggttttcctttttccgatccgctactcgat
ggcccagttattcaagccgcgaataatcgtgctttaactgcgggtcatagcagtgaagat
agctttaaactattggaaaaagtgcggtcaaaatatcccgagattccgattagcttatta
ctttgtgccaatttaatttttgctaaaggtttagatgctttttatcaacgttgtgcagaa
gtcggggttgatgctgtgcttgtggcagatattccgttactcgcaaaagaagattatgta
caagcggctaaaaaacacggcattcaacccgtctttatttgcccgccaaatgcggacgag
aaaacgatccaaggcgtagcggaaaatagcgaaggctatacctatttagtttcccgtgct
ggcgtaaccagtgcagaaaatcaagcccacgcagcaaatttggatacccttgtagaacag
cttaaggcacataatgccccaccaattttacaaggcttcggcattgctcaaccagagcaa
gttaaagaagcgttgtctttgggcactgcgggtgcaatttcaggttcggcaacggtgaaa
attattgagcgaaatttagataatcacgagcaatgtttagctgaattagctgaatttgtt
caaacaatgaaagctgcaacaaaataa

DBGET integrated database retrieval system