KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_05610
Entry
CGSHiGG_05610     CDS       T00544                                 

Definition
(GenBank) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00340  Histidine metabolism
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hiq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CGSHiGG_05610
Enzymes [BR:hiq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     CGSHiGG_05610
SSDB
Motif
Pfam: His_biosynth NanE FMN_dh NMO IMPDH IGPS Dus Trp_syntA TMP-TENI Glu_synthase PEP_mutase G3P_antiterm
Other DBs
NCBI-ProteinID: ABR00041
UniProt: A5UGY5
Position
1022242..1022991
AA seq 249 aa
MKQSIIIPALDLINGQVVRLHQGDYAKQTTYSDNPIKQFDNYVRQGAKQLHLVDLTGAKN
PQSRQTALIGKIVEATQCKVQVGGGIRTEQDVADLLAVGANRVVIGSTAVTHRSMVKNWF
IKYGAEKFVLALDVNINASGQKIVAISGWQEESGVLLETLIEDFQTVGLQQVLCTDISRD
GTLTGSNIGLYQEICEKYPPIQFQSSGGIGSLADIEALKGTGVSGVIVGRALLEGKFTLS
EAIKCWQNG
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaaacaatctattattatccctgctcttgatcttatcaatggtcaagttgtgcggtta
caccaaggcgattatgccaagcaaactacctattctgacaatccaattaagcaatttgat
aattatgtacgtcaaggagcaaaacaactacatctagtcgatttaacgggagcgaaaaat
ccccagtcaagacaaaccgcacttattggaaaaatcgttgaagcaacacaatgtaaagta
caagtaggaggaggcattcgtacagagcaagatgtggcagatttattggctgtgggtgcg
aatcgcgtggtgattggttcaaccgccgtaactcatcgttcaatggtgaaaaactggttc
atcaaatatggtgcggaaaaatttgttctagcattagacgtgaatattaatgcaagcggt
cagaaaatcgttgcgattagcggttggcaggaagaaagtggtgtactattagaaacgttg
atcgaagatttccaaaccgttggcttacaacaagttttatgtaccgatatttcacgcgat
ggcaccttgacaggttcaaatattggactttatcaagaaatttgtgagaaatatccacct
attcagtttcaatcttctggagggattggttcactggctgatattgaggctctaaaaggc
acaggtgtgtcaggtgtaattgtaggtcgcgctttattagaaggaaaatttacgctttcg
gaggcaatcaaatgttggcaaaacggataa

DBGET integrated database retrieval system