KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_07350Help
Entry
CGSHiGG_07350     CDS       T00544                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00071  Fatty acid degradation
hiq00280  Valine, leucine and isoleucine degradation
hiq00310  Lysine degradation
hiq00380  Tryptophan metabolism
hiq00620  Pyruvate metabolism
hiq00630  Glyoxylate and dicarboxylate metabolism
hiq00640  Propanoate metabolism
hiq00650  Butanoate metabolism
hiq00900  Terpenoid backbone biosynthesis
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01120  Microbial metabolism in diverse environments
hiq01130  Biosynthesis of antibiotics
hiq01200  Carbon metabolism
hiq01212  Fatty acid metabolism
hiq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hiq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CGSHiGG_07350
   00630 Glyoxylate and dicarboxylate metabolism
    CGSHiGG_07350
   00640 Propanoate metabolism
    CGSHiGG_07350
   00650 Butanoate metabolism
    CGSHiGG_07350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CGSHiGG_07350
   00072 Synthesis and degradation of ketone bodies
    CGSHiGG_07350
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CGSHiGG_07350
   00310 Lysine degradation
    CGSHiGG_07350
   00380 Tryptophan metabolism
    CGSHiGG_07350
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CGSHiGG_07350
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CGSHiGG_07350
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CGSHiGG_07350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hiq04147]
    CGSHiGG_07350
Enzymes [BR:hiq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CGSHiGG_07350
Exosome [BR:hiq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGSHiGG_07350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABR00331
UniProt: A5UHS5
Position
complement(1364603..1365784)
Genome map
AA seq 393 aa AA seqDB search
MENVVIVSAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIVPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVSAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattgttagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggtgcaattgtgatacaagaagccatcaaacgt
gccaacattgaaagtgcattagttaatgaagtcatcatggggaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcggaacaatatggtattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
gtccctgttatggtaaaaactcgcaaaggtgacattattgtttcacgagacgagtatcct
aaagcagatactacagccgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtctccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacagttcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttggacttgctacactttgtatt
ggcggtggtcaaggtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system