KEGG   Heterobasidion irregulare: HETIRDRAFT_104673
Entry
HETIRDRAFT_104673 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
hir  Heterobasidion irregulare
Pathway
hir00910  Nitrogen metabolism
hir01100  Metabolic pathways
Module
hir_M00531  Assimilatory nitrate reduction, nitrate => ammonia
hir_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    HETIRDRAFT_104673
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     HETIRDRAFT_104673
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Rieske_2 Fer2_BFD Pyr_redox Rieske NIR_SIR_ferr Rubredoxin_C FAD_binding_2
Other DBs
NCBI-GeneID: 20666021
NCBI-ProteinID: XP_009545962
JGI: Hetan2_104673
UniProt: W4K7I3
Position
Unknown
AA seq 1124 aa
MDPIPSDCQRRRVFVVGLGMVGIAFIEKLLNLDIAQNYHITTCGEEPHFAYNRVGLTDYF
QHRSIENLYLNSPSWYAEQEPDRFQFYIGEQVTDIDTKAKTVTTSKNNTFSYDILVLATG
SEAAYPPYITPAQASSTDGIYVYRSIADLEKIIEYASREGVESASIVGGGLLGLEAAKAV
YDLHLPRVSIMNRQSYLLSRQLDADAGEMVLRKVEAMGVQIVTNAKVAGITTNTAFAGDH
ERFTGFQMDDGSHFASDMVICAVGIRGRDDLAKNSGIMCEAKGGVKVDDDLRTSAADVYA
IGECANWRGNTYGLIAPGIEMADILSFNLTQTNTSMGTHLPRKMNDPDLSTKLKLMGVDV
ASFGDFFADKDPSRMQSSIEFHRRKQAEKQAEKNGARKEGQAKLQIILEDGGVEAVHKDP
TPPKIKHRGVNLRDEPIKCLTYKDPFGSVYKKYIFTADGKYLLGGMMIGDVSDYTKLVAI
VKKRKPLDQPPSQFIVGSKSDGGDDGADLDGDAQICSCHNVTKGKISACVRSGRDNLNDL
KALTKAGTGCGGCMPLVTSIFKTEMKKSGKELSPALCAHFDMPRADLFNVIRIKRLETWT
DVIRELGKKSVDTVGCETCKPAVGSILASLFNRHVMEPDLHQLQDTNDRFLANIQRNGTF
SVVPRIAGGELTPDALITIGTVAKKYKLYTKITGGQRIDMFGAKKADLPDIWEELVKAGF
ESGHAYGKALRTVKSCVGTSWCRYGVGDAVGMAIELENRYRGVRAPHKIKGGVSGCIREC
AEAQSKDFGLIATDKGWNIFIAGNGGANPRHASLFAKDVLPSQVVRILDRYLMFYIRTAD
KLMRTARWVESFEGGKLKKIILEDELGICGDLEREMSELVGTFECEWTQVVKDPKRRKAF
RQFVNSDETVQTIDNIVERGQLRPADWPKAFPPSKMEVSQIATPRSQWKWRKMAKVEDLV
PSDAGTTSAAVKYGASALAIFHVPRRGYYATQQMCPHKHAFVLDHGLVGDDANGNLYVSC
PLHKKNFSLDNGDCFNDGQYKILAFDVKQDGEDLLIHLPEADELDAVLNTTKWMVKAATA
EALERNDATEVEIVGPDGESAGSDLNVGECASAAGGCGSTELDW
NT seq 3375 nt   +upstreamnt  +downstreamnt
atggaccccattccctcagattgtcaacgcagacgcgtatttgtcgttggcctgggcatg
gtcggcatcgctttcatcgaaaagctgctgaacctcgatatagcccaaaattaccacatc
accacctgtggggaagaaccccacttcgcgtacaaccgtgttggcctgacggactatttc
cagcatcggagcatcgagaacttgtacttgaacagcccatcgtggtatgccgagcaggaa
cccgatcggttccagttctatatcggagaacaagtcactgacatcgacaccaaagccaaa
acggtgacgactagcaagaacaacacattctcgtacgacatccttgttctcgcgactggt
tctgaggccgcatacccaccttatatcactccagcacaagccagctccactgatggtatc
tacgtttaccgatcgatcgcagacctcgagaagatcattgaatatgccagccgcgaaggt
gtcgaatcagcgagcattgtgggcggagggcttttgggtctggaagccgcgaaagcggtt
tatgatctccatttgccgcgagtctccatcatgaatcgtcaatcgtacctactgtccagg
caactcgacgctgacgccggagagatggtcctgcgcaaagtcgaggcaatgggcgtccag
atcgtaaccaatgccaaagtcgctggaatcaccactaataccgcttttgcgggtgaccac
gagcgcttcactgggttccagatggacgacggctctcactttgctagcgacatggtcatc
tgtgctgtaggcattcggggtcgagatgacttggcgaagaatagtggtatcatgtgcgag
gccaagggaggggttaaagtggacgacgatttacgaacatcagctgcagatgtttacgct
ataggggagtgcgcaaattggagaggtaacacttacggattaattgctcccggaatagaa
atggccgacattctctcgttcaatcttacacagacgaacacttcaatgggaacccactta
cctcgcaagatgaatgacccggacctgtcgaccaagctaaagctcatgggcgtcgatgtc
gcgtctttcggtgactttttcgcggacaaagatccttctcgaatgcaatcttcgatcgag
ttccacaggagaaaacaagcagagaaacaagcagagaagaacggtgccagaaaggaaggg
caagcgaaactgcagatcatattggaggatggtggcgtcgaagcagtgcacaaagacccg
accccgccaaagatcaagcataggggggtgaacttgcgcgacgaaccgatcaagtgtctg
acatacaaggatcctttcgggtccgtatacaaaaagtacatcttcactgctgatggcaaa
tatctgcttggtggtatgatgatcggagacgtttccgactacaccaagctcgtcgcgatt
gtgaagaagcgcaagcccctcgatcagcctccatcacagttcatcgtgggttccaaaagc
gatggtggcgacgacggagcagatttggacggtgacgcacagatttgcagctgccataat
gtgaccaaagggaaaattagcgcgtgcgtgcgctcgggacgcgacaacttgaacgacctc
aaggccttgaccaaggctggaactgggtgcggtggttgcatgccgctcgttaccagcatc
ttcaagacggagatgaaaaaaagcggcaaggagctcagcccagcgctttgcgctcatttt
gacatgccgcgcgctgacctcttcaatgtcatccgaatcaagcgactagagacatggacc
gacgtcattcgcgagctggggaagaagtcggtggataccgtggggtgcgagacctgcaag
ccggcggtcggaagcatcctcgccagcctgttcaatcgtcacgtcatggagcctgacctt
catcaactccaagacaccaacgacagatttctcgccaatatacagcggaacggcacgttc
tctgttgtcccacggattgccggcggcgagctaacccctgacgcactcatcaccatcggg
acggtggcaaagaagtacaagctgtacaccaagattaccggcgggcagcgcatcgacatg
ttcggcgcgaagaaggcagacctgcccgatatctgggaagagttggtgaaagcgggcttc
gagagtgggcacgcgtatggcaaggcgctgcggacggtgaagagctgtgttgggacatcg
tggtgccgttatggtgtcggcgacgctgtcgggatggccatcgagctcgaaaacaggtac
agaggcgtgcgcgcgccgcacaagatcaaaggaggcgtgtcaggatgcatccgagagtgc
gccgaggcacagagcaaggactttgggttgatcgctacagacaaagggtggaacattttc
atcgcgggcaacggcggtgccaacccacgccatgcttcgttgtttgccaaagatgtcctc
ccgtcccaggtcgtccgaatcctcgaccggtacttgatgttctatatccgcacggcggac
aaactgatgcggacagcacgatgggtagagagcttcgagggcggcaaactaaaaaagatc
atcctggaagacgaactagggatttgtggagacctcgaacgcgagatgagcgaactagtg
gggaccttcgagtgcgagtggacccaagttgtcaaggacccgaaacgtcggaaagccttc
cggcagttcgtgaactcggatgagaccgtccagactattgacaatatcgtcgaacgtggg
cagttacgtcctgcagattggcccaaggcattcccgccgtcgaagatggaagtaagtcag
attgcaacgccgaggtcgcagtggaaatggagaaagatggcgaaggtggaagatcttgtc
cccagtgatgcgggaacgacgtcggcagcagtcaagtacggtgcctctgcgttagccatc
tttcatgtgcctcggcgtggatactacgccacacaacagatgtgtccccacaaacatgca
ttcgtccttgaccacggtttggttggagatgacgcgaacgggaatctctacgtctcctgc
ccactgcacaagaaaaacttttccctcgacaacggcgactgcttcaacgacgggcaatac
aaaatcctcgcgttcgacgtgaaacaggacggggaggacctgctcattcatctccccgag
gcggacgagttggacgcggtactcaacaccacgaagtggatggtaaaagctgcgacggca
gaagcgctggagaggaacgatgcgactgaagtggagatcgtcggccctgatggcgagagc
gcaggtagcgatttgaatgtaggagaatgcgcgtctgcggcaggcgggtgtggatcaaca
gagctggattggtag

DBGET integrated database retrieval system