KEGG   Heterobasidion irregulare: HETIRDRAFT_312503Help
Entry
HETIRDRAFT_312503 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
hir  Heterobasidion irregulare
Pathway
hir00970  Aminoacyl-tRNA biosynthesis
hir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hir00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HETIRDRAFT_312503
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hir03029]
    HETIRDRAFT_312503
Enzymes [BR:hir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HETIRDRAFT_312503
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HETIRDRAFT_312503
Mitochondrial biogenesis [BR:hir03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HETIRDRAFT_312503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 20669960
NCBI-ProteinID: XP_009543808
JGI: Hetan2_312503
UniProt: W4KE60
Position
Unknown
AA seq 521 aa AA seqDB search
MLPRQAVSCLSLQKVYGPRWFHCSRRHSADARWPGWEVIVGIEVHAQIKSRKKLFSHSPN
SDPGAPANIHVSPYDAAFPGTLPHLNRKCVELALRTAIALKSDIQRRSSFDRKHYFYADL
PAGYQITQRYEPLAKGGYLKLPETGAVVGIEQIQLEQDTGKSSFDSRRRLSAIDLNRAGT
GLMEIVSNPDMRLVAQLDVCHGQSPEEAGEYVRTLQALLRSVGSSDGNMEQGSLRCDVNV
SVNRPGEKPGTRCEIKNLNSVKFTMVAIGSEVLRQISLIESGQPVSQETRGFNEDTGETY
RLRGKEDAPDYRYMPDPNLPPLLLEHSFVDGIRANMPELPDEVRSRLQAQGLSQRDVDVL
MAVDSGREVGFDGALGQGALYAGFDRMTHELLGQLALRRETFKENPVSVECMGNLIDLLQ
SGMITGTSGKTLLRHMLDHRSDKMPVEIAQELSLIALSEGEDLLEKMCSEAVIALPAEAD
AVRRGNLQVLNKLVGWVMKSSRGRADAQAVRANLKKMLAPN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccgccaggcagtgtcatgtctgtctcttcaaaaagtctacggtcctagatgg
tttcattgttcgagaaggcacagcgctgatgcgagatggccaggatgggaggtcattgta
gggatagaggtccatgcacagatcaagtcacgcaaaaagctgttctctcattcgccaaat
tcggatccaggggctcctgctaatatccatgtatccccgtacgacgctgcttttcccggg
acgctaccacacttgaataggaaatgcgtagagcttgctctgaggactgccattgctctc
aaatctgatatacagagacgatcttctttcgaccgaaaacactacttctatgcggatctt
ccagccgggtaccaaatcacacagcgttacgagcctctcgctaaaggaggttacctgaaa
cttcctgaaacaggtgctgtagttggtattgagcagatacaactcgaacaggacacgggg
aaatcatcgtttgattcacgaagacgtctctccgcaattgatcttaacagagctggtaca
gggctcatggagatcgtctcaaatcctgacatgaggctagtcgcacagcttgatgtttgc
cacggccaatcgccagaagaagcgggagagtatgtaaggacattgcaggctctgcttagg
tccgtcggatctagcgatggtaacatggaacagggatcacttcgttgcgacgtcaatgtc
tctgtcaatcgtccaggagagaaaccaggaacaagatgtgaaatcaagaacttaaacagc
gtcaagttcaccatggtggccatagggtctgaagtcctacggcagatctctctgatagag
agtggtcagcctgtctctcaggaaacccgtggattcaatgaggacaccggcgaaacgtat
cgtctacgtggaaaagaagatgcaccagactatcgttacatgccggaccccaacctccca
ccgctccttctagaacatagctttgtagacggcatacgtgctaatatgcccgagcttcca
gatgaggttcggtcccgattgcaggctcagggcctaagtcaacgagacgtcgatgtcctc
atggccgtagattcggggcgcgaagttgggtttgacggcgctctcggtcagggtgccctt
tacgccggtttcgataggatgacacacgagcttctcggccagttagcccttcgtcgagaa
acgttcaaggagaacccggtctccgtggagtgcatgggaaacttgattgatttattacaa
agtggtatgattactggaacatctggcaagaccctcctacgacacatgcttgaccacagg
tcggacaagatgccagtggagatagcacaagagctttctctcattgcactgagcgaaggc
gaagatcttctggaaaagatgtgctctgaagctgtcatagccttgcccgctgaggccgat
gctgttcgtcgtggcaatctccaggtccttaataagctcgtggggtgggtgatgaagtcg
agtaggggaagggctgacgctcaagccgtcagggcgaatttaaagaaaatgctggcacca
aactaa

DBGET integrated database retrieval system