KEGG   Heterobasidion irregulare: HETIRDRAFT_318728
Entry
HETIRDRAFT_318728 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
hir  Heterobasidion irregulare
Pathway
hir00100  Steroid biosynthesis
hir01100  Metabolic pathways
hir01110  Biosynthesis of secondary metabolites
Module
hir_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    HETIRDRAFT_318728
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     HETIRDRAFT_318728
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 20670531
NCBI-ProteinID: XP_009546657
JGI: Hetan2_318728
UniProt: W4K8D3
Position
Unknown
AA seq 429 aa
MTDLNPRTKSYEFLGPPGALAVTIGVPIMTYALYFSCSEVSGGCPPTPLSTLIPTIQQAV
SDTEWWKSLLDTKALAIYSSWYAFCIVAWAILPGDWVQGSQLRNGKYQSYKINAFSTSLL
ALGLATGYIMRFGVQSFTFFYEHWVGFVTAALLNSILQGLLWYGLSFCQGKLLALGGNSG
NPIYDFYIGRELNPTVLGLDIKSFNELRPGMILWLLIDISMACEQATRLGGRITDSMGLV
LFFQSLYIMDALYNEPAILTTMDIISDGFGFMLSVGDLVWVPFVYSLQARYLAFHPKDLG
YTWSAAILAVNFLGYWIFRSANNEKNEFRNGRNPKNLTYMPTERGTKLLTSGWWGASRHP
NYMGDLLMALAWSLPTGFETPVTYFYVVYFAVLLIHRQRRDDENCEKKYGKDWHKYMKLV
PYRIIPFIY
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgacagacctcaaccctcgcaccaaatcctatgagtttctcgggcctcctggggccctt
gccgtgaccataggcgttcccatcatgacctatgccctctacttctcttgcagcgaggtt
tcaggcggttgccctcccactcccctctctaccttgatccctaccattcaacaggccgtc
tctgatacagagtggtggaaaagccttttggataccaaggctctcgcaatctactcgtct
tggtacgcgttttgtattgtggcatgggctattctcccaggcgactgggttcagggatct
cagcttcgcaatgggaaatatcaaagttacaagataaacgcattctctacgtccctcctc
gctctcggtctcgccacaggatacatcatgcgttttggagtccagtctttcaccttcttc
tacgaacattgggtaggattcgtgacagccgccttgctcaactccatccttcaaggcttg
ctctggtatggactttcattctgccaaggaaagctacttgctctcggtggcaattccggg
aatcccatctatgatttctatatcggtcgcgagctgaatccgaccgtacttggtttggat
atcaagtctttcaacgaactgaggccagggatgatcttgtggttattgattgatatcagc
atggcctgcgagcaggccactcgtctcggaggacgtatcaccgactcgatgggtctcgta
ctcttcttccagtctttgtatatcatggatgctttgtacaacgagcccgcgatccttacg
accatggatatcatctccgatgggtttggcttcatgctctctgtcggtgacctggtttgg
gttccctttgtttactcactccaggcacgctaccttgctttccatccgaaagatcttgga
tatacatggagtgctgccattttggctgtcaatttcctcggctactggatcttcagaagc
gcgaacaacgagaaaaatgaattccgcaacggacggaaccccaagaatctcacgtacatg
cccaccgagcgtggcacgaagcttttgacttccggttggtggggagcttctcgccaccca
aattatatgggtgacctgttgatggcgttggcgtggtccttgcccaccggcttcgagacc
cctgtcacctacttctacgttgtttactttgctgtcctcctgatccaccgacagcgacgt
gatgacgaaaactgtgagaaaaagtacggcaaagactggcacaagtacatgaagctggtt
ccctaccgcatcatcccgttcatctactga

DBGET integrated database retrieval system