KEGG   Heterobasidion irregulare: HETIRDRAFT_379742Help
Entry
HETIRDRAFT_379742 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
hir  Heterobasidion irregulare
Pathway
hir00860  Porphyrin and chlorophyll metabolism
hir01100  Metabolic pathways
hir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HETIRDRAFT_379742
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     HETIRDRAFT_379742
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     HETIRDRAFT_379742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_C Sirohm_synth_M TrkA_N Shikimate_DH Pyr_redox_3 Oxidored_nitro Pyr_redox Pyr_redox_2 AlaDh_PNT_C ThiF
Motif
Other DBs
NCBI-GeneID: 20671983
NCBI-ProteinID: XP_009542507
JGI: Hetan2_379742
UniProt: W4KIJ3
Position
Unknown
AA seq 226 aa AA seqDB search
MIAWQLRDKRVLVVGGGDVASGRIGHVLAAGAEVTVVSPRAGLHPATKQHIDASDRITYH
DRTFVAADLDGADMVLTAIDDVAVSRAIAAQCRALRIPVNVADDPPCCDFYFGSQIRQGP
LQIMISTNGRGPKLANIIRRRIEESLPRGAGEAIEKVGRLREKLKERAPGVGGDVSRRRM
RWMVDLCTAWEMDELALLSEEQMERMLDEGWEKDSVLSPEALGVGS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcttggcagctcagagacaaacgagtgttggtcgtgggcggcggtgatgttgcg
tcagggcgcatcgggcacgtactcgcagccggggcagaggtcacggtggtgtcgccccgc
gcgggcctccatcccgcgacgaagcagcacatcgacgcgtccgaccgcatcacgtaccac
gaccgcaccttcgtcgcggcagacctggacggggcggacatggtcctcaccgccatcgac
gacgtcgccgtctcgcgcgcgatcgcggcccagtgccgggcgctgcgcatccccgtgaac
gtggccgacgacccgccctgctgcgatttctacttcggctcgcagatccgccagggcccg
ttgcagatcatgatctccacgaacgggcggggtccgaagctggcgaatatcatacggcgc
aggatcgaggagagcctgccgcggggggccggagaggccattgagaaggtggggcggctg
agggagaagctcaaggagcgtgcgcccggcgtgggcggtgacgtgagcaggcggcgcatg
aggtggatggtcgacctgtgcaccgcgtgggagatggacgagctggcgctcttgagcgag
gagcagatggagaggatgctcgacgagggctgggaaaaagactctgtgctcagcccagag
gcgctgggagtggggtcgtga

DBGET integrated database retrieval system