KEGG   Heterobasidion irregulare: HETIRDRAFT_39750Help
Entry
HETIRDRAFT_39750  CDS       T03455                                 

Definition
(RefSeq) carbohydrate esterase family 9 protein
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
hir  Heterobasidion irregulare
Pathway
hir00520  Amino sugar and nucleotide sugar metabolism
hir01100  Metabolic pathways
hir01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HETIRDRAFT_39750
Enzymes [BR:hir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     HETIRDRAFT_39750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 20672499
NCBI-ProteinID: XP_009553039
JGI: Hetan2_39750
UniProt: W4JN11
Position
Unknown
AA seq 438 aa AA seqDB search
MTSPNGLICFTNCLIPLEDGSLVKKDLWIDERRGVVLDSQHTFYHRKERPQRMIDLGGNI
ISPGFLDIQINGAYGFDFSVYEGDDEAYRRGMRTVSENIVETGVTSLVPTVITQERSLYP
ILLNLLRPFHSSNGATLLGWHAEGPFLHMAKRGAHAPPFLLTAPKGVSTFEDVYGVPNIS
HTEDWLMDGGVGVRIITGAPEIEGVMDAIKDLTARGIVFSIGHSIATTDIATAAVRRGAR
LITHLFNAMPQLHHRDPSIIGLLDMTFERPFYEMIVDGIHSHPNSVRLAYNVFPEGCILI
TDAMKILDPHLRDGVHEWRDGKRFVKEGDRLYLEGTDTLAGRQAQVIVSRSFITAAYPHV
RSVVTLDKCVRNFARFTGCSLGEALKCVTLNPARCLGIENKKGTLRPGADADLVVLDRMG
NVLSTWVGGREVWARSSD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgccgaacggcctcatatgcttcactaactgcttgatcccactagaggatggg
agcctcgtcaagaaagacttgtggatcgacgagcgccgaggtgtggtcctggattcccag
cacacattttatcacaggaaagagaggccacaaaggatgatagatctcggcggcaacatc
ataagccctggcttcttggatatccagatcaacggggcgtacggcttcgacttctcagtg
tatgaaggtgacgacgaggcgtacagacgagggatgcgaactgtttctgagaacatcgta
gaaacaggcgtcacatctttagtaccaacagtcatcacacaagaaagatccctttatcca
attctcctgaacctccttcgaccctttcactcatccaatggagcaacacttctcgggtgg
catgcagagggccccttccttcacatggccaagcggggtgcacatgccccaccattcctt
ctcaccgcgcccaagggtgtctctactttcgaagacgtctatggtgtgccgaatatctcc
catacagaggactggctcatggacggcggtgtcggtgtgcgcatcatcacgggcgcgccc
gagattgagggcgtcatggacgccatcaaggacttgacggcgcggggtatcgtcttttct
atcggacacagcattgcgacgacagacattgcgacggcagccgtacgacgcggcgcgcgt
ctcatcacgcacctcttcaatgccatgccgcagctgcaccaccgcgatccgtccatcatc
gggctcctcgatatgacgtttgagcggccgttctacgagatgatcgttgacgggatccac
tcgcaccccaattccgtccggcttgcgtataacgtattcccggaaggttgtattttgatc
acagacgcgatgaagatactcgacccacacctgcgcgacggcgtacatgaatggcgcgac
ggcaaacggtttgtcaaagaaggcgaccggctttatctcgagggcacggacaccctcgcc
ggcaggcaagcccaagtcatcgtctcacggtctttcatcacggctgcttacccgcatgta
cgcagcgttgtaacactagacaaatgtgtacgcaactttgcccgtttcacgggttgctcc
ctcggcgaagcgctcaagtgcgtgacgctgaacccggcacggtgccttggcatcgagaac
aagaagggcacgctccgccccggggcggatgcagacctcgtcgtgctcgacagaatgggt
aatgttttgagcacatgggtcggcgggcgggaggtgtgggcgcgcagctcagattag

DBGET integrated database retrieval system