KEGG   Heterobasidion irregulare: HETIRDRAFT_42076Help
Entry
HETIRDRAFT_42076  CDS       T03455                                 

Definition
(RefSeq) glycoside hydrolase family 28 protein
  KO
K18580  rhamnogalacturonan hydrolase [EC:3.2.1.171]
Organism
hir  Heterobasidion irregulare
Brite
KEGG Orthology (KO) [BR:hir00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HETIRDRAFT_42076
Enzymes [BR:hir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.171  rhamnogalacturonan hydrolase
     HETIRDRAFT_42076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 20673674
NCBI-ProteinID: XP_009540350
JGI: Hetan2_42076
UniProt: W4KL54
Position
Unknown
AA seq 447 aa AA seqDB search
MLLNALRLLALLPAVALVEAQLSGTVGPTTKLSAKGHTCSVLDYGGKVGSTDIGPAIASA
FTNCVVKNSGSTLYIPAGNYEMKTWVTLNHGTKWAFQLDGLITRTATTGGHMILIENADD
FEMYSANSAGGIQGHGYQCRNAGYVSFSFAPRLIRIVNSNNWSIHDLILVDSPEFHLIVQ
EGSNGEVYNMAIRGANIGGSDGIDISGNNHWVHDVEVTNRDECVTVKSPASNFLIERIWC
NQSGGSAIGSLGANTAISNIVYRNIYTNGGNQAMMIKSHGGSGSVTNVLMQDFISHGTAY
GLTIDQYWSSQAEQAGSGVKLSKIQFKNWDGEVVDGVQRAPAQFICADGAPCEGVTLDNV
NMWGATGKANYKCRSAFGTGACLKSGSAGSYAQTTVAYSRPVNYHTPSKMSGDLAAGFAT
NAAIPTPTIPTSYYPGLSQITPLAKNL
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttacttaacgcccttcgccttttggctctcttgcctgcggtagcgctcgttgaagcg
caattatcaggcacggtaggacctaccaccaagttatctgccaaggggcacacttgcagc
gtcttggactatggaggcaaagtcggcagcaccgacatcgggcccgccatagccagcgcg
ttcacgaactgtgtcgtgaaaaactcagggtcgacattgtacatccccgccgggaactac
gagatgaagacttgggtaacgttgaaccatggaacgaagtgggccttccaacttgatggg
cttattacccgcacagcaactaccggaggacacatgatcttgatcgagaacgcagacgat
ttcgagatgtacagcgcaaactcggctggcggcatccaaggtcacggataccagtgccgt
aacgcagggtatgtctctttttctttcgcccctcggctcattcgtattgtgaactccaac
aactggtcgatccacgacttgatcctcgtggactctcccgagttccatctcatagttcaa
gagggatccaacggagaagtgtataacatggccatccgtggtgcgaatattggtggcagc
gacggtatagacatcagtggaaacaaccattgggtccatgatgtcgaggtcacgaaccgc
gacgagtgcgtcactgtcaaaagcccagcatccaacttcttgattgagcgcatttggtgc
aaccaatctggaggaagcgccattggcagcctgggcgccaacactgcaatctctaacatt
gtttaccgcaacatctacacaaacggtggcaaccaagctatgatgatcaagtcgcacggc
ggttccggaagtgtcaccaacgtgctcatgcaggacttcatttctcacggtaccgcgtac
ggcctcactatcgatcagtactggtccagccaagcagaacaggctggttcaggtgttaag
ctcagcaagatccagttcaagaactgggacggcgaagtcgtcgacggcgtccaacgcgcc
cctgcacaattcatctgtgccgatggggcgccatgcgaaggcgtcactctggacaacgtg
aacatgtggggcgcgacaggcaaggcgaactacaagtgccgctctgccttcgggactggc
gcgtgcctgaagtcgggcagcgcaggcagctacgctcagaccacggtagcatattccagg
ccagtcaattaccacactccgagcaagatgtcaggagacctggccgctgggttcgcgacg
aacgccgcaatccctacccccacgatccctacttcgtactatcctggtctttcacagatc
actcccctggcgaaaaatctctag

DBGET integrated database retrieval system