KEGG   Heterobasidion irregulare: HETIRDRAFT_422965Help
Entry
HETIRDRAFT_422965 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
hir  Heterobasidion irregulare
Brite
KEGG Orthology (KO) [BR:hir00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HETIRDRAFT_422965
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     HETIRDRAFT_422965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_FMN
Motif
Other DBs
NCBI-GeneID: 20673858
NCBI-ProteinID: XP_009552677
JGI: Hetan2_422965
UniProt: W4JP18
Position
Unknown
AA seq 370 aa AA seqDB search
MSVQSKLFETIRVGKCDLKHRVVMAPLTRLRHSATHVPGPGAAEYYAQRASTPGTLVVTE
STVIAPQAGGFEYGLNTPGIWSDEQISEWKKVVEAVHAKGSFIFVQLWAMGRAASPSILA
LDGPELPYVGASDIPLRGRDHEPPAALTIPEIKEYAQLHATAAINAVHKAGFDGVEINCA
MGFLLDQFLQDVSNNRTDEYGGSIENRIRFPLEMIGAVVDAVGADRVGLKLSPWNSFQDM
RMADPVPTFSALVTRIRDVHPEFAYINVKEARIEGTSERPTTAEENNEFLRKIWGARPYL
ASGGYNREDAIKTADEKGGLIVFGRWFISNPDLPVRLKKNIPLSPYDPNTFYTPDNVKGY
TDYPFSGEDW
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttcagtccaaactcttcgagaccatccgcgtcggtaaatgcgatctcaagcat
cgcgtggtcatggctccccttactcgcttgagacatagcgcgacccacgtccctgggccc
ggcgccgcagaatactacgctcagcgggccagcaccccaggaacgctcgtcgttacagag
tcaacagtgattgctccccaggccggcggatttgagtatggcctaaacaccccaggcatc
tggtccgacgagcagatctccgagtggaaaaaggttgtcgaagccgtacatgcgaaagga
tcgttcatctttgttcagctctgggctatgggacgcgccgctagcccttccatactagct
ctcgacggtcctgagcttccttacgttggggccagcgacattcccctccgtggacgcgac
catgaacctcccgccgcactcaccattccagaaatcaaagagtatgctcagttgcatgcc
acggccgccatcaacgctgttcacaaggctggtttcgatggggtggaaattaactgcgcc
atgggattccttttggatcagttcttgcaggacgtgtcgaacaaccggactgatgaatat
ggcggatcgattgagaacaggatcaggtttccgcttgagatgatcggggctgttgttgac
gcggtcggtgcagacagggtggggttgaagctcagtccatggaattctttccaggatatg
cgcatggccgatccagttccgacattcagtgccttggtcactcgtattcgtgatgtacat
cctgaattcgcctacatcaacgtcaaggaagctcgcatcgagggaacctccgagaggcct
actacggctgaagaaaataacgagttcctcaggaagatatggggtgcgagaccgtatctt
gcatccggaggatacaacagggaggatgccatcaaaaccgctgatgagaaaggcggactt
atcgtgtttgggaggtggttcatttcaaatcccgatcttcccgttcggttgaagaagaat
attcccctcagcccctacgaccccaatacattttacacgcctgataatgtcaaagggtat
acggactatcccttctcaggagaagattggtaa

DBGET integrated database retrieval system