KEGG   Heterobasidion irregulare: HETIRDRAFT_439662Help
Entry
HETIRDRAFT_439662 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
Organism
hir  Heterobasidion irregulare
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf URO-D
Motif
Other DBs
NCBI-GeneID: 20675173
NCBI-ProteinID: XP_009545435
JGI: Hetan2_439662
UniProt: W4KBI1
Position
Unknown
AA seq 290 aa AA seqDB search
MGEHSPCDALVPIIVAEYAIIQSIDEALFSASEPSHDFSQADGGIGWQRLDWVTDTCVEL
ECTQAEERAKGIIADSNDTRLSPDAYVQMALQLAWFKTRGTFTATYETVLTRLFDRGRTE
TIRTLTADSRAFVLAMMAPSSSLAERQTLLRRATQTHTTLTREAATGKGIDRHLLGLQLM
LRPEDGERSPLFEDEFFQESKAWKLSTSGLSAGHLFRGTGFGAAYNDGYGINYLVGPDLI
KLGIESKHSCHHTSTAGLQAAIVEALREMELVCTESRPLRITLVMLNIVS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcattcaccctgtgatgccttggtgccaatcatagttgccgaatacgctatc
attcagagcatagatgaagcgttattttctgcttctgaaccttcgcacgacttttcacag
gctgacggtggaataggatggcagcgtctagattgggttactgatacctgcgttgaatta
gagtgtacacaggcagaagagcgggcgaaaggtatcatagcagattcgaatgacactcga
ctgtctcccgatgcatatgtgcaaatggctttacaactagcttggttcaagactcgcggc
acattcacagcaacgtacgagactgtgttgacacgtctcttcgatcgtggtcggacggag
acaattcgtactctaactgcggacagtcgtgcattcgttctcgccatgatggctccttcg
agctctcttgctgaacgtcaaacgctacttcgtcgcgcgactcaaactcacaccacgttg
acgcgtgaagctgccactggcaaaggcatcgatcgacatctattgggccttcagctgatg
ctacgtcctgaagatggcgagcgaagtcctctgttcgaggatgaattctttcaggagagt
aaggcttggaaacttagtaccagtgggctgagcgctggacatctgttcaggggaacgggg
ttcggcgcggcgtataacgacggctacggtatcaattatcttgtgggcccagacctcata
aaactcggaatcgagtcgaaacattcatgtcatcacacatcgactgcaggtttgcaagcc
gccatagttgaagctttacgagaaatggagttggtctgtacagagagcagaccattgcgg
atcaccctcgtcatgcttaacatcgtgagctaa

DBGET integrated database retrieval system