KEGG   Heterobasidion irregulare: HETIRDRAFT_59461Help
Entry
HETIRDRAFT_59461  CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
hir  Heterobasidion irregulare
Pathway
hir00020  Citrate cycle (TCA cycle)
hir00640  Propanoate metabolism
hir01100  Metabolic pathways
hir01110  Biosynthesis of secondary metabolites
hir01130  Biosynthesis of antibiotics
hir01200  Carbon metabolism
Module
hir_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hir_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HETIRDRAFT_59461
   00640 Propanoate metabolism
    HETIRDRAFT_59461
Enzymes [BR:hir01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     HETIRDRAFT_59461
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HETIRDRAFT_59461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 20678475
NCBI-ProteinID: XP_009540409
JGI: Hetan2_59461
UniProt: W4KQR5
Position
Unknown
AA seq 331 aa AA seqDB search
MLSRVSHSLAASAGRRAFSSSPARRSYEDTIRNLLINKDTRVLCQGFTGKTGTFHVKEAL
AYGTNMVGGVSPKKAGQTHLGLPVFGSVREAVRETKPDASVLYVPPPSAADAIIEAIENE
IGLIVCITEGIPQADEIRVINALKSQSKSRLVGPNCPGIINPLGCKMGIQPGHIHKPGKI
GIVSRSGTLTYEAVAQTTDVGLGQSLCVGIGGDPFPGTQHVDVIKVFLEDDNTEGIVIIG
EIGGSMEEEAAEYLQRYNLSRSKPKPVVGFIAGRTAPPGRRMGHAGAIIAGGKGAASDKV
TALEAAGVIVTDSPAKIGSEMLKAMKAAGLI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctcgtgtaagtcactcactggctgccagcgctggacgccgggcgttctcttcg
tctcctgcgagaaggagctatgaagacaccatccggaacctactcattaacaaggacacc
agagtactttgccagggatttactgggaagaccggtactttccatgtaaaggaagcgttg
gcgtacggcacgaacatggtcgggggtgtttcgcctaagaaagccggccagacccaccta
ggcctccccgttttcggttctgtgagggaggctgttcgtgagactaaacccgatgcctct
gtcctctatgtccctccaccctctgctgctgatgccatcatcgaggccattgagaacgag
ataggtctcattgtctgtattacagagggtatcccccaggctgatgagatccgcgttata
aatgctttgaagagccagtctaagtcccgacttgtagggcccaactgccctggtatcatc
aacccattgggttgtaagatgggcatccagcccggccacattcataaacccgggaagatc
ggtatcgtctctcgctcagggaccttgacgtatgaagctgtcgcgcagactaccgatgtc
ggccttggccagtctctttgcgtcggtatcggtggtgatcctttccctggaacccagcat
gtcgatgtgatcaaggttttcctcgaagatgacaacactgaaggtatcgttatcatcggc
gagattggtggtagcatggaagaggaagctgccgagtacctccagaggtacaacctcagc
cgctccaaaccaaaacccgttgttggcttcatcgctggacgcaccgcgccccctggtcgc
cgtatgggtcacgctggtgccatcattgccggtggaaagggtgccgcatcggacaaggtt
actgctctcgaggcagccggtgtcatcgtcacggacagcccggcgaaaatcggctcggag
atgcttaaagccatgaaagctgccggccttatatag

DBGET integrated database retrieval system