KEGG   Heterobasidion irregulare: HETIRDRAFT_61272Help
Entry
HETIRDRAFT_61272  CDS       T03455                                 

Gene name
GS1
Definition
(RefSeq) glutathione synthase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
hir  Heterobasidion irregulare
Pathway
hir00270  Cysteine and methionine metabolism
hir00480  Glutathione metabolism
hir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    HETIRDRAFT_61272 (GS1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HETIRDRAFT_61272 (GS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hir04147]
    HETIRDRAFT_61272 (GS1)
Enzymes [BR:hir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     HETIRDRAFT_61272 (GS1)
Exosome [BR:hir04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HETIRDRAFT_61272 (GS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase MRP-L20
Motif
Other DBs
NCBI-GeneID: 20678546
NCBI-ProteinID: XP_009545865
JGI: Hetan2_61272
UniProt: W4K8U7
Position
Unknown
AA seq 497 aa AA seqDB search
MSKFTSWPPELTSEQVEQLTLLATTYALSHSLLYLPPHSASNPPPPSPTSAIHAPFSLLP
TPIPRRHFDLVSRLQSTYNVLYSRIAMDEAFLDKIMGEGGVASVDDFTGELWRRWKQLRV
EGIVQPLQLGLFRSDYLLDQSSEADPLSLKQVEFNTISSSFGALSQQVSLLHKYLLASTN
YFNASPLLKSVNLPFNDTVAGLVSGLAAAHKAYDVESAHILFVVQPGERNIFDQRLLEYE
LLEKHSIHIIRRSFADLASTATLHPSTRALIVTHNADSVEISTVYYRAGYTPADYPTPAA
YDTRQLLERSRAIQCPSLALQLAGGKKVQEVLTHPGVLERFLHADEGLEDIRATWMEMWG
LDSDATRSGVDRAREQASQLVLKPQREGGGNNVYKSAIPAFLDSLPERERGAWIAMKLIR
PPRGVGGYLVQAGSGGHGIVQSDVVSELGIFGWSLFGNGKVNEEKAVGWLVRTKSEGVDE
GGVATGFSVLDSVVLVD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtttacatcctggcctcccgaattgacctcggaacaagtcgagcagctcacc
ttgctcgcgacgacctatgcactatcccattctctcctctatctcccaccccactctgcg
tcgaatccccctcctccatcgccaacatcagcgatacatgctccgttttcactgttaccg
actccaatccctcgccggcacttcgatctcgtgagccgtctccagagcacatataatgtg
ctatattcccgcatcgcgatggatgaagcattcctcgacaagatcatgggtgaagggggt
gtggcaagcgtggatgacttcaccggagagttatggaggcgttggaagcagctgagagtc
gaagggattgtgcagcctctccaactcggcctcttccgctcggattacctcttggatcag
tcatcggaggcggacccgctatcgctcaagcaagtcgagtttaataccatctcgtcctct
tttggcgcgctctcgcaacaggtctcgctgttgcataaatacctgctggcttcgacaaat
tacttcaacgcgtcgccgctcctgaaatctgtcaatcttcccttcaatgatacagtcgcg
ggactggtctctggcctcgcggcagcacacaaggcatatgatgtagaatctgcccatatc
ctattcgtggtacaaccaggagagaggaacatatttgatcagaggttactcgaatacgag
ctcctagagaagcattccatccacatcatccgccgctccttcgccgatctcgcatccacc
gccacccttcatccctctacacgcgcgctcatcgtcacgcacaacgccgattctgtcgag
atttcgactgtatactaccgtgcaggttacactccggcggactatcccacccccgccgca
tacgatacccgccaactgctcgagcgctcgcgcgccatacagtgcccatctctcgccctc
cagctcgcgggcggaaagaaggttcaagaggtcctcactcatccaggcgtgctggagcgc
ttcctacacgccgacgagggcctcgaggacattcgcgcgacctggatggaaatgtggggc
ctcgattcagacgcgacgcgatccggggtcgatcgcgcgcgcgaacaggccagccagctc
gtgctcaagcctcagcgcgaaggcggagggaacaacgtgtacaaaagcgcgattcctgcg
tttcttgattcccttccggagcgcgagcgcggggcgtggatcgcaatgaagttgattcgt
cctccgcgtggtgtcggggggtatctcgtgcaggcgggaagcggtgggcatgggattgtt
caatcggatgtcgtgagcgagcttggaatttttgggtggtcgctttttgggaatgggaaa
gtcaacgaggagaaggctgttggatggttggttcggacgaagagtgagggtgtggatgag
ggtggggtcgcgactgggttctctgtgcttgacagtgttgttcttgtggattga

DBGET integrated database retrieval system